data_2LCA # _entry.id 2LCA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LCA pdb_00002lca 10.2210/pdb2lca/pdb RCSB RCSB102220 ? ? BMRB 17575 ? 10.13018/BMR17575 WWPDB D_1000102220 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-01-04 2 'Structure model' 1 1 2012-01-18 3 'Structure model' 1 2 2012-02-15 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2023-12-06 6 'Structure model' 1 5 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Derived calculations' 9 6 'Structure model' 'Database references' 10 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' struct_conn 10 5 'Structure model' struct_conn_type 11 6 'Structure model' database_2 12 6 'Structure model' pdbx_entry_details 13 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' 6 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 4 'Structure model' '_struct_ref_seq_dif.details' 8 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LCA _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-04-26 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 17575 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Marassi, F.' 1 'Yao, Y.' 2 # _citation.id primary _citation.title 'Molecular Structure and Peptidoglycan Recognition of Mycobacterium tuberculosis ArfA (Rv0899).' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 416 _citation.page_first 208 _citation.page_last 220 _citation.year 2012 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22206986 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2011.12.030 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yao, Y.' 1 ? primary 'Barghava, N.' 2 ? primary 'Kim, J.' 3 ? primary 'Niederweis, M.' 4 ? primary 'Marassi, F.M.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein Rv0899/MT0922' _entity.formula_weight 14096.714 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'OmpA-like residues 196-326' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSA QRAKIVADYLVARGVAGDHIATVGLGSVNPIASNATPEGRAKNRRVEIVVNHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;GQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSA QRAKIVADYLVARGVAGDHIATVGLGSVNPIASNATPEGRAKNRRVEIVVNHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLN n 1 3 ALA n 1 4 PRO n 1 5 PRO n 1 6 GLY n 1 7 PRO n 1 8 PRO n 1 9 ALA n 1 10 SER n 1 11 GLY n 1 12 PRO n 1 13 CYS n 1 14 ALA n 1 15 ASP n 1 16 LEU n 1 17 GLN n 1 18 SER n 1 19 ALA n 1 20 ILE n 1 21 ASN n 1 22 ALA n 1 23 VAL n 1 24 THR n 1 25 GLY n 1 26 GLY n 1 27 PRO n 1 28 ILE n 1 29 ALA n 1 30 PHE n 1 31 GLY n 1 32 ASN n 1 33 ASP n 1 34 GLY n 1 35 ALA n 1 36 SER n 1 37 LEU n 1 38 ILE n 1 39 PRO n 1 40 ALA n 1 41 ASP n 1 42 TYR n 1 43 GLU n 1 44 ILE n 1 45 LEU n 1 46 ASN n 1 47 ARG n 1 48 VAL n 1 49 ALA n 1 50 ASP n 1 51 LYS n 1 52 LEU n 1 53 LYS n 1 54 ALA n 1 55 CYS n 1 56 PRO n 1 57 ASP n 1 58 ALA n 1 59 ARG n 1 60 VAL n 1 61 THR n 1 62 ILE n 1 63 ASN n 1 64 GLY n 1 65 TYR n 1 66 THR n 1 67 ASP n 1 68 ASN n 1 69 THR n 1 70 GLY n 1 71 SER n 1 72 GLU n 1 73 GLY n 1 74 ILE n 1 75 ASN n 1 76 ILE n 1 77 PRO n 1 78 LEU n 1 79 SER n 1 80 ALA n 1 81 GLN n 1 82 ARG n 1 83 ALA n 1 84 LYS n 1 85 ILE n 1 86 VAL n 1 87 ALA n 1 88 ASP n 1 89 TYR n 1 90 LEU n 1 91 VAL n 1 92 ALA n 1 93 ARG n 1 94 GLY n 1 95 VAL n 1 96 ALA n 1 97 GLY n 1 98 ASP n 1 99 HIS n 1 100 ILE n 1 101 ALA n 1 102 THR n 1 103 VAL n 1 104 GLY n 1 105 LEU n 1 106 GLY n 1 107 SER n 1 108 VAL n 1 109 ASN n 1 110 PRO n 1 111 ILE n 1 112 ALA n 1 113 SER n 1 114 ASN n 1 115 ALA n 1 116 THR n 1 117 PRO n 1 118 GLU n 1 119 GLY n 1 120 ARG n 1 121 ALA n 1 122 LYS n 1 123 ASN n 1 124 ARG n 1 125 ARG n 1 126 VAL n 1 127 GLU n 1 128 ILE n 1 129 VAL n 1 130 VAL n 1 131 ASN n 1 132 HIS n 1 133 HIS n 1 134 HIS n 1 135 HIS n 1 136 HIS n 1 137 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Rv0899, MT0922, MTCY31.27' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pet21b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 196 196 GLY GLY A . n A 1 2 GLN 2 197 197 GLN GLN A . n A 1 3 ALA 3 198 198 ALA ALA A . n A 1 4 PRO 4 199 199 PRO PRO A . n A 1 5 PRO 5 200 200 PRO PRO A . n A 1 6 GLY 6 201 201 GLY GLY A . n A 1 7 PRO 7 202 202 PRO PRO A . n A 1 8 PRO 8 203 203 PRO PRO A . n A 1 9 ALA 9 204 204 ALA ALA A . n A 1 10 SER 10 205 205 SER SER A . n A 1 11 GLY 11 206 206 GLY GLY A . n A 1 12 PRO 12 207 207 PRO PRO A . n A 1 13 CYS 13 208 208 CYS CYS A . n A 1 14 ALA 14 209 209 ALA ALA A . n A 1 15 ASP 15 210 210 ASP ASP A . n A 1 16 LEU 16 211 211 LEU LEU A . n A 1 17 GLN 17 212 212 GLN GLN A . n A 1 18 SER 18 213 213 SER SER A . n A 1 19 ALA 19 214 214 ALA ALA A . n A 1 20 ILE 20 215 215 ILE ILE A . n A 1 21 ASN 21 216 216 ASN ASN A . n A 1 22 ALA 22 217 217 ALA ALA A . n A 1 23 VAL 23 218 218 VAL VAL A . n A 1 24 THR 24 219 219 THR THR A . n A 1 25 GLY 25 220 220 GLY GLY A . n A 1 26 GLY 26 221 221 GLY GLY A . n A 1 27 PRO 27 222 222 PRO PRO A . n A 1 28 ILE 28 223 223 ILE ILE A . n A 1 29 ALA 29 224 224 ALA ALA A . n A 1 30 PHE 30 225 225 PHE PHE A . n A 1 31 GLY 31 226 226 GLY GLY A . n A 1 32 ASN 32 227 227 ASN ASN A . n A 1 33 ASP 33 228 228 ASP ASP A . n A 1 34 GLY 34 229 229 GLY GLY A . n A 1 35 ALA 35 230 230 ALA ALA A . n A 1 36 SER 36 231 231 SER SER A . n A 1 37 LEU 37 232 232 LEU LEU A . n A 1 38 ILE 38 233 233 ILE ILE A . n A 1 39 PRO 39 234 234 PRO PRO A . n A 1 40 ALA 40 235 235 ALA ALA A . n A 1 41 ASP 41 236 236 ASP ASP A . n A 1 42 TYR 42 237 237 TYR TYR A . n A 1 43 GLU 43 238 238 GLU GLU A . n A 1 44 ILE 44 239 239 ILE ILE A . n A 1 45 LEU 45 240 240 LEU LEU A . n A 1 46 ASN 46 241 241 ASN ASN A . n A 1 47 ARG 47 242 242 ARG ARG A . n A 1 48 VAL 48 243 243 VAL VAL A . n A 1 49 ALA 49 244 244 ALA ALA A . n A 1 50 ASP 50 245 245 ASP ASP A . n A 1 51 LYS 51 246 246 LYS LYS A . n A 1 52 LEU 52 247 247 LEU LEU A . n A 1 53 LYS 53 248 248 LYS LYS A . n A 1 54 ALA 54 249 249 ALA ALA A . n A 1 55 CYS 55 250 250 CYS CYS A . n A 1 56 PRO 56 251 251 PRO PRO A . n A 1 57 ASP 57 252 252 ASP ASP A . n A 1 58 ALA 58 253 253 ALA ALA A . n A 1 59 ARG 59 254 254 ARG ARG A . n A 1 60 VAL 60 255 255 VAL VAL A . n A 1 61 THR 61 256 256 THR THR A . n A 1 62 ILE 62 257 257 ILE ILE A . n A 1 63 ASN 63 258 258 ASN ASN A . n A 1 64 GLY 64 259 259 GLY GLY A . n A 1 65 TYR 65 260 260 TYR TYR A . n A 1 66 THR 66 261 261 THR THR A . n A 1 67 ASP 67 262 262 ASP ASP A . n A 1 68 ASN 68 263 263 ASN ASN A . n A 1 69 THR 69 264 264 THR THR A . n A 1 70 GLY 70 265 265 GLY GLY A . n A 1 71 SER 71 266 266 SER SER A . n A 1 72 GLU 72 267 267 GLU GLU A . n A 1 73 GLY 73 268 268 GLY GLY A . n A 1 74 ILE 74 269 269 ILE ILE A . n A 1 75 ASN 75 270 270 ASN ASN A . n A 1 76 ILE 76 271 271 ILE ILE A . n A 1 77 PRO 77 272 272 PRO PRO A . n A 1 78 LEU 78 273 273 LEU LEU A . n A 1 79 SER 79 274 274 SER SER A . n A 1 80 ALA 80 275 275 ALA ALA A . n A 1 81 GLN 81 276 276 GLN GLN A . n A 1 82 ARG 82 277 277 ARG ARG A . n A 1 83 ALA 83 278 278 ALA ALA A . n A 1 84 LYS 84 279 279 LYS LYS A . n A 1 85 ILE 85 280 280 ILE ILE A . n A 1 86 VAL 86 281 281 VAL VAL A . n A 1 87 ALA 87 282 282 ALA ALA A . n A 1 88 ASP 88 283 283 ASP ASP A . n A 1 89 TYR 89 284 284 TYR TYR A . n A 1 90 LEU 90 285 285 LEU LEU A . n A 1 91 VAL 91 286 286 VAL VAL A . n A 1 92 ALA 92 287 287 ALA ALA A . n A 1 93 ARG 93 288 288 ARG ARG A . n A 1 94 GLY 94 289 289 GLY GLY A . n A 1 95 VAL 95 290 290 VAL VAL A . n A 1 96 ALA 96 291 291 ALA ALA A . n A 1 97 GLY 97 292 292 GLY GLY A . n A 1 98 ASP 98 293 293 ASP ASP A . n A 1 99 HIS 99 294 294 HIS HIS A . n A 1 100 ILE 100 295 295 ILE ILE A . n A 1 101 ALA 101 296 296 ALA ALA A . n A 1 102 THR 102 297 297 THR THR A . n A 1 103 VAL 103 298 298 VAL VAL A . n A 1 104 GLY 104 299 299 GLY GLY A . n A 1 105 LEU 105 300 300 LEU LEU A . n A 1 106 GLY 106 301 301 GLY GLY A . n A 1 107 SER 107 302 302 SER SER A . n A 1 108 VAL 108 303 303 VAL VAL A . n A 1 109 ASN 109 304 304 ASN ASN A . n A 1 110 PRO 110 305 305 PRO PRO A . n A 1 111 ILE 111 306 306 ILE ILE A . n A 1 112 ALA 112 307 307 ALA ALA A . n A 1 113 SER 113 308 308 SER SER A . n A 1 114 ASN 114 309 309 ASN ASN A . n A 1 115 ALA 115 310 310 ALA ALA A . n A 1 116 THR 116 311 311 THR THR A . n A 1 117 PRO 117 312 312 PRO PRO A . n A 1 118 GLU 118 313 313 GLU GLU A . n A 1 119 GLY 119 314 314 GLY GLY A . n A 1 120 ARG 120 315 315 ARG ARG A . n A 1 121 ALA 121 316 316 ALA ALA A . n A 1 122 LYS 122 317 317 LYS LYS A . n A 1 123 ASN 123 318 318 ASN ASN A . n A 1 124 ARG 124 319 319 ARG ARG A . n A 1 125 ARG 125 320 320 ARG ARG A . n A 1 126 VAL 126 321 321 VAL VAL A . n A 1 127 GLU 127 322 322 GLU GLU A . n A 1 128 ILE 128 323 323 ILE ILE A . n A 1 129 VAL 129 324 324 VAL VAL A . n A 1 130 VAL 130 325 325 VAL VAL A . n A 1 131 ASN 131 326 326 ASN ASN A . n A 1 132 HIS 132 327 ? ? ? A . n A 1 133 HIS 133 328 ? ? ? A . n A 1 134 HIS 134 329 ? ? ? A . n A 1 135 HIS 135 330 ? ? ? A . n A 1 136 HIS 136 331 ? ? ? A . n A 1 137 HIS 137 332 ? ? ? A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TYR 237 ? OH ? A TYR 42 OH 2 1 Y 1 A TYR 260 ? OH ? A TYR 65 OH 3 1 Y 1 A TYR 284 ? OH ? A TYR 89 OH 4 1 Y 1 A ASN 326 ? O ? A ASN 131 O 5 2 Y 1 A TYR 237 ? OH ? A TYR 42 OH 6 2 Y 1 A TYR 260 ? OH ? A TYR 65 OH 7 2 Y 1 A TYR 284 ? OH ? A TYR 89 OH 8 2 Y 1 A ASN 326 ? O ? A ASN 131 O 9 3 Y 1 A TYR 237 ? OH ? A TYR 42 OH 10 3 Y 1 A TYR 260 ? OH ? A TYR 65 OH 11 3 Y 1 A TYR 284 ? OH ? A TYR 89 OH 12 3 Y 1 A ASN 326 ? O ? A ASN 131 O 13 4 Y 1 A TYR 237 ? OH ? A TYR 42 OH 14 4 Y 1 A TYR 260 ? OH ? A TYR 65 OH 15 4 Y 1 A TYR 284 ? OH ? A TYR 89 OH 16 4 Y 1 A ASN 326 ? O ? A ASN 131 O 17 5 Y 1 A TYR 237 ? OH ? A TYR 42 OH 18 5 Y 1 A TYR 260 ? OH ? A TYR 65 OH 19 5 Y 1 A TYR 284 ? OH ? A TYR 89 OH 20 5 Y 1 A ASN 326 ? O ? A ASN 131 O 21 6 Y 1 A TYR 237 ? OH ? A TYR 42 OH 22 6 Y 1 A TYR 260 ? OH ? A TYR 65 OH 23 6 Y 1 A TYR 284 ? OH ? A TYR 89 OH 24 6 Y 1 A ASN 326 ? O ? A ASN 131 O 25 7 Y 1 A TYR 237 ? OH ? A TYR 42 OH 26 7 Y 1 A TYR 260 ? OH ? A TYR 65 OH 27 7 Y 1 A TYR 284 ? OH ? A TYR 89 OH 28 7 Y 1 A ASN 326 ? O ? A ASN 131 O 29 8 Y 1 A TYR 237 ? OH ? A TYR 42 OH 30 8 Y 1 A TYR 260 ? OH ? A TYR 65 OH 31 8 Y 1 A TYR 284 ? OH ? A TYR 89 OH 32 8 Y 1 A ASN 326 ? O ? A ASN 131 O 33 9 Y 1 A TYR 237 ? OH ? A TYR 42 OH 34 9 Y 1 A TYR 260 ? OH ? A TYR 65 OH 35 9 Y 1 A TYR 284 ? OH ? A TYR 89 OH 36 9 Y 1 A ASN 326 ? O ? A ASN 131 O 37 10 Y 1 A TYR 237 ? OH ? A TYR 42 OH 38 10 Y 1 A TYR 260 ? OH ? A TYR 65 OH 39 10 Y 1 A TYR 284 ? OH ? A TYR 89 OH 40 10 Y 1 A ASN 326 ? O ? A ASN 131 O 41 11 Y 1 A TYR 237 ? OH ? A TYR 42 OH 42 11 Y 1 A TYR 260 ? OH ? A TYR 65 OH 43 11 Y 1 A TYR 284 ? OH ? A TYR 89 OH 44 11 Y 1 A ASN 326 ? O ? A ASN 131 O 45 12 Y 1 A TYR 237 ? OH ? A TYR 42 OH 46 12 Y 1 A TYR 260 ? OH ? A TYR 65 OH 47 12 Y 1 A TYR 284 ? OH ? A TYR 89 OH 48 12 Y 1 A ASN 326 ? O ? A ASN 131 O 49 13 Y 1 A TYR 237 ? OH ? A TYR 42 OH 50 13 Y 1 A TYR 260 ? OH ? A TYR 65 OH 51 13 Y 1 A TYR 284 ? OH ? A TYR 89 OH 52 13 Y 1 A ASN 326 ? O ? A ASN 131 O 53 14 Y 1 A TYR 237 ? OH ? A TYR 42 OH 54 14 Y 1 A TYR 260 ? OH ? A TYR 65 OH 55 14 Y 1 A TYR 284 ? OH ? A TYR 89 OH 56 14 Y 1 A ASN 326 ? O ? A ASN 131 O 57 15 Y 1 A TYR 237 ? OH ? A TYR 42 OH 58 15 Y 1 A TYR 260 ? OH ? A TYR 65 OH 59 15 Y 1 A TYR 284 ? OH ? A TYR 89 OH 60 15 Y 1 A ASN 326 ? O ? A ASN 131 O 61 16 Y 1 A TYR 237 ? OH ? A TYR 42 OH 62 16 Y 1 A TYR 260 ? OH ? A TYR 65 OH 63 16 Y 1 A TYR 284 ? OH ? A TYR 89 OH 64 16 Y 1 A ASN 326 ? O ? A ASN 131 O 65 17 Y 1 A TYR 237 ? OH ? A TYR 42 OH 66 17 Y 1 A TYR 260 ? OH ? A TYR 65 OH 67 17 Y 1 A TYR 284 ? OH ? A TYR 89 OH 68 17 Y 1 A ASN 326 ? O ? A ASN 131 O 69 18 Y 1 A TYR 237 ? OH ? A TYR 42 OH 70 18 Y 1 A TYR 260 ? OH ? A TYR 65 OH 71 18 Y 1 A TYR 284 ? OH ? A TYR 89 OH 72 18 Y 1 A ASN 326 ? O ? A ASN 131 O 73 19 Y 1 A TYR 237 ? OH ? A TYR 42 OH 74 19 Y 1 A TYR 260 ? OH ? A TYR 65 OH 75 19 Y 1 A TYR 284 ? OH ? A TYR 89 OH 76 19 Y 1 A ASN 326 ? O ? A ASN 131 O 77 20 Y 1 A TYR 237 ? OH ? A TYR 42 OH 78 20 Y 1 A TYR 260 ? OH ? A TYR 65 OH 79 20 Y 1 A TYR 284 ? OH ? A TYR 89 OH 80 20 Y 1 A ASN 326 ? O ? A ASN 131 O # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LCA _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LCA _struct.title 'Solution structure of the C domain of RV0899 from mycobacterium tuberculosis' _struct.pdbx_model_details 'lowest energy, model 20' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LCA _struct_keywords.pdbx_keywords 'peptidoglycan-binding protein' _struct_keywords.text 'peptidoglycan-binding protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y899_MYCTU _struct_ref.pdbx_db_accession P65593 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSA QRAKIVADYLVARGVAGDHIATVGLGSVNPIASNATPEGRAKNRRVEIVVN ; _struct_ref.pdbx_align_begin 196 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LCA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 131 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P65593 _struct_ref_seq.db_align_beg 196 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 326 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 196 _struct_ref_seq.pdbx_auth_seq_align_end 326 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LCA HIS A 132 ? UNP P65593 ? ? 'expression tag' 327 1 1 2LCA HIS A 133 ? UNP P65593 ? ? 'expression tag' 328 2 1 2LCA HIS A 134 ? UNP P65593 ? ? 'expression tag' 329 3 1 2LCA HIS A 135 ? UNP P65593 ? ? 'expression tag' 330 4 1 2LCA HIS A 136 ? UNP P65593 ? ? 'expression tag' 331 5 1 2LCA HIS A 137 ? UNP P65593 ? ? 'expression tag' 332 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 15 ? GLY A 25 ? ASP A 210 GLY A 220 1 ? 11 HELX_P HELX_P2 2 TYR A 42 ? CYS A 55 ? TYR A 237 CYS A 250 1 ? 14 HELX_P HELX_P3 3 ILE A 74 ? ARG A 93 ? ILE A 269 ARG A 288 1 ? 20 HELX_P HELX_P4 4 ALA A 96 ? ASP A 98 ? ALA A 291 ASP A 293 5 ? 3 HELX_P HELX_P5 5 THR A 116 ? ARG A 124 ? THR A 311 ARG A 319 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 13 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 55 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 208 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 250 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.022 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 13 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 55 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 208 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 250 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 100 ? GLY A 106 ? ILE A 295 GLY A 301 A 2 VAL A 60 ? TYR A 65 ? VAL A 255 TYR A 260 A 3 VAL A 126 ? VAL A 130 ? VAL A 321 VAL A 325 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 101 ? O ALA A 296 N ILE A 62 ? N ILE A 257 A 2 3 N THR A 61 ? N THR A 256 O VAL A 129 ? O VAL A 324 # _pdbx_entry_details.entry_id 2LCA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 OD1 A ASP 262 ? ? HG1 A THR 264 ? ? 1.53 2 3 OD2 A ASP 262 ? ? HH21 A ARG 319 ? ? 1.59 3 5 O A ARG 254 ? ? H A ASN 326 ? ? 1.57 4 12 O A ARG 254 ? ? H A ASN 326 ? ? 1.57 5 14 OD2 A ASP 262 ? ? HG1 A THR 264 ? ? 1.57 6 17 OD1 A ASP 262 ? ? HG1 A THR 264 ? ? 1.58 7 20 OD1 A ASP 262 ? ? HG1 A THR 264 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 209 ? ? -47.43 153.44 2 1 PRO A 234 ? ? -49.14 157.97 3 1 ASP A 236 ? ? -67.99 -100.09 4 1 VAL A 303 ? ? -134.98 -67.72 5 1 ARG A 320 ? ? -58.18 170.86 6 2 ALA A 198 ? ? 62.24 88.89 7 2 SER A 205 ? ? 63.16 -179.32 8 2 ALA A 230 ? ? -119.31 -74.69 9 2 SER A 231 ? ? -94.61 -66.82 10 2 LEU A 232 ? ? 67.57 98.01 11 2 ALA A 235 ? ? -142.28 -85.01 12 2 VAL A 303 ? ? -174.90 148.45 13 2 ASN A 304 ? ? 64.08 75.03 14 3 ALA A 198 ? ? 71.29 83.85 15 3 PRO A 207 ? ? -81.03 32.91 16 3 SER A 231 ? ? -162.06 113.56 17 3 VAL A 303 ? ? -142.94 -61.27 18 3 ARG A 320 ? ? -57.50 177.60 19 4 SER A 205 ? ? 54.45 -154.27 20 4 ALA A 230 ? ? 65.82 171.65 21 4 SER A 231 ? ? 58.23 -155.62 22 4 ASN A 304 ? ? 52.22 77.59 23 4 ILE A 306 ? ? -127.70 -55.72 24 4 ARG A 320 ? ? -57.42 170.69 25 5 ALA A 198 ? ? 70.39 128.19 26 5 SER A 205 ? ? 58.60 88.33 27 5 ALA A 230 ? ? 70.86 -56.57 28 5 SER A 231 ? ? -81.68 36.46 29 5 LEU A 232 ? ? 63.60 104.94 30 5 ALA A 235 ? ? -152.30 -71.18 31 5 ASP A 236 ? ? -118.06 -75.96 32 5 TYR A 237 ? ? 71.47 -51.94 33 5 GLU A 267 ? ? -160.98 -46.02 34 5 VAL A 303 ? ? -150.21 -60.91 35 5 ILE A 306 ? ? -134.13 -48.62 36 5 ARG A 320 ? ? -58.34 179.00 37 6 PRO A 200 ? ? -83.31 39.86 38 6 ALA A 204 ? ? -74.27 27.34 39 6 ALA A 230 ? ? -117.55 -164.33 40 6 ALA A 235 ? ? -69.66 2.31 41 6 SER A 266 ? ? -69.05 -83.99 42 6 GLU A 267 ? ? 176.01 168.60 43 6 VAL A 303 ? ? 179.81 152.65 44 6 ASN A 304 ? ? 66.44 79.03 45 6 ARG A 320 ? ? -63.18 -173.69 46 7 ALA A 198 ? ? 61.52 91.88 47 7 SER A 205 ? ? 73.79 -55.32 48 7 ASN A 227 ? ? -109.05 -78.26 49 7 ASP A 228 ? ? -178.94 115.15 50 7 VAL A 303 ? ? -149.25 -56.52 51 7 ILE A 306 ? ? -124.34 -53.59 52 8 ALA A 198 ? ? 65.10 98.95 53 8 SER A 205 ? ? 66.92 87.07 54 8 ALA A 230 ? ? -138.83 -90.47 55 8 ILE A 233 ? ? 67.30 94.90 56 8 ALA A 235 ? ? -164.99 -67.49 57 8 VAL A 303 ? ? -138.00 -69.38 58 8 ARG A 320 ? ? -57.78 177.79 59 9 ALA A 198 ? ? 53.11 77.48 60 9 SER A 205 ? ? 54.71 -154.89 61 9 ASN A 227 ? ? -95.71 -100.82 62 9 ASP A 228 ? ? 170.05 -58.56 63 9 ALA A 230 ? ? 77.63 -55.71 64 9 ILE A 233 ? ? 58.26 73.15 65 9 ALA A 235 ? ? -145.22 -7.75 66 9 VAL A 303 ? ? -179.33 147.02 67 9 ASN A 304 ? ? 64.95 69.33 68 9 ILE A 306 ? ? -128.12 -50.00 69 9 ARG A 320 ? ? -57.66 175.90 70 10 SER A 231 ? ? 55.49 -174.28 71 10 THR A 261 ? ? -174.13 114.18 72 10 ASN A 263 ? ? -129.85 -56.01 73 10 SER A 266 ? ? -149.60 -64.95 74 11 ALA A 198 ? ? 67.34 103.01 75 11 SER A 205 ? ? 72.15 -43.45 76 11 ASP A 228 ? ? -177.95 88.72 77 11 ALA A 230 ? ? -149.62 -73.33 78 11 SER A 231 ? ? 68.24 -160.87 79 11 TYR A 237 ? ? -81.30 35.84 80 11 VAL A 303 ? ? -136.95 -69.41 81 11 ARG A 320 ? ? -57.53 173.66 82 12 ALA A 198 ? ? 69.03 88.91 83 12 ALA A 209 ? ? -59.68 178.24 84 12 ASP A 228 ? ? 73.07 131.08 85 12 ALA A 230 ? ? -115.87 -90.98 86 12 SER A 231 ? ? -169.99 -155.29 87 12 PRO A 234 ? ? -49.07 159.12 88 12 SER A 266 ? ? -92.69 34.46 89 12 ASN A 304 ? ? 70.29 74.52 90 12 ARG A 320 ? ? -58.61 177.74 91 13 ALA A 198 ? ? 61.90 76.30 92 13 SER A 205 ? ? 54.08 -143.89 93 13 PRO A 207 ? ? -59.16 106.95 94 13 ALA A 230 ? ? -152.56 20.55 95 13 LEU A 232 ? ? 58.23 73.85 96 13 ASN A 304 ? ? 65.90 78.87 97 13 ARG A 320 ? ? -65.42 -174.38 98 14 ALA A 198 ? ? -157.96 71.25 99 14 PRO A 200 ? ? -84.07 47.24 100 14 ALA A 230 ? ? 72.37 -58.49 101 14 LEU A 232 ? ? 61.82 87.34 102 14 VAL A 303 ? ? -146.85 -59.27 103 14 ILE A 306 ? ? -131.27 -48.12 104 14 ARG A 320 ? ? -57.14 177.76 105 15 PRO A 203 ? ? -56.41 107.86 106 15 PRO A 207 ? ? -89.75 37.55 107 15 SER A 231 ? ? -177.32 -177.50 108 15 ASN A 304 ? ? 61.66 81.98 109 15 ARG A 320 ? ? -58.74 178.58 110 16 GLN A 197 ? ? -143.89 -49.82 111 16 PRO A 200 ? ? -74.87 22.13 112 16 PRO A 203 ? ? -81.58 -70.39 113 16 PHE A 225 ? ? -172.20 141.34 114 16 ASP A 236 ? ? 66.44 94.60 115 16 VAL A 303 ? ? -176.80 148.20 116 16 ASN A 304 ? ? 62.39 78.64 117 16 ARG A 320 ? ? -61.33 -176.32 118 17 SER A 231 ? ? 61.08 -161.13 119 17 ALA A 235 ? ? -79.67 42.22 120 17 ASN A 304 ? ? 66.46 79.96 121 17 ARG A 320 ? ? -69.39 -176.98 122 18 ASP A 228 ? ? -143.44 -33.48 123 18 ALA A 230 ? ? 70.97 -60.49 124 18 VAL A 303 ? ? -140.46 -64.67 125 18 ARG A 320 ? ? -69.03 -174.67 126 19 ALA A 209 ? ? -54.03 174.60 127 19 ASN A 263 ? ? -61.57 2.90 128 19 GLU A 267 ? ? 66.05 169.44 129 19 VAL A 303 ? ? -141.74 -58.66 130 19 ARG A 320 ? ? -57.16 176.28 131 20 ALA A 198 ? ? -139.94 -54.90 132 20 PRO A 200 ? ? -55.68 -74.93 133 20 SER A 231 ? ? 67.86 91.11 134 20 LEU A 232 ? ? -88.97 43.59 135 20 ALA A 235 ? ? 63.21 -154.24 136 20 GLU A 267 ? ? -156.13 3.36 137 20 VAL A 303 ? ? -143.79 -61.00 138 20 ARG A 320 ? ? -57.43 178.87 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LCA _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LCA _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '0.5 mM [U-99% 13C; U-99% 15N] protein, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component protein-1 _pdbx_nmr_exptl_sample.concentration 0.5 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCACB' 1 3 1 '3D C(CO)NH' 1 4 1 '3D H(CCO)NH' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D 1H-13C NOESY aliphatic' # _pdbx_nmr_refine.entry_id 2LCA _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 1 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 327 ? A HIS 132 2 1 Y 1 A HIS 328 ? A HIS 133 3 1 Y 1 A HIS 329 ? A HIS 134 4 1 Y 1 A HIS 330 ? A HIS 135 5 1 Y 1 A HIS 331 ? A HIS 136 6 1 Y 1 A HIS 332 ? A HIS 137 7 2 Y 1 A HIS 327 ? A HIS 132 8 2 Y 1 A HIS 328 ? A HIS 133 9 2 Y 1 A HIS 329 ? A HIS 134 10 2 Y 1 A HIS 330 ? A HIS 135 11 2 Y 1 A HIS 331 ? A HIS 136 12 2 Y 1 A HIS 332 ? A HIS 137 13 3 Y 1 A HIS 327 ? A HIS 132 14 3 Y 1 A HIS 328 ? A HIS 133 15 3 Y 1 A HIS 329 ? A HIS 134 16 3 Y 1 A HIS 330 ? A HIS 135 17 3 Y 1 A HIS 331 ? A HIS 136 18 3 Y 1 A HIS 332 ? A HIS 137 19 4 Y 1 A HIS 327 ? A HIS 132 20 4 Y 1 A HIS 328 ? A HIS 133 21 4 Y 1 A HIS 329 ? A HIS 134 22 4 Y 1 A HIS 330 ? A HIS 135 23 4 Y 1 A HIS 331 ? A HIS 136 24 4 Y 1 A HIS 332 ? A HIS 137 25 5 Y 1 A HIS 327 ? A HIS 132 26 5 Y 1 A HIS 328 ? A HIS 133 27 5 Y 1 A HIS 329 ? A HIS 134 28 5 Y 1 A HIS 330 ? A HIS 135 29 5 Y 1 A HIS 331 ? A HIS 136 30 5 Y 1 A HIS 332 ? A HIS 137 31 6 Y 1 A HIS 327 ? A HIS 132 32 6 Y 1 A HIS 328 ? A HIS 133 33 6 Y 1 A HIS 329 ? A HIS 134 34 6 Y 1 A HIS 330 ? A HIS 135 35 6 Y 1 A HIS 331 ? A HIS 136 36 6 Y 1 A HIS 332 ? A HIS 137 37 7 Y 1 A HIS 327 ? A HIS 132 38 7 Y 1 A HIS 328 ? A HIS 133 39 7 Y 1 A HIS 329 ? A HIS 134 40 7 Y 1 A HIS 330 ? A HIS 135 41 7 Y 1 A HIS 331 ? A HIS 136 42 7 Y 1 A HIS 332 ? A HIS 137 43 8 Y 1 A HIS 327 ? A HIS 132 44 8 Y 1 A HIS 328 ? A HIS 133 45 8 Y 1 A HIS 329 ? A HIS 134 46 8 Y 1 A HIS 330 ? A HIS 135 47 8 Y 1 A HIS 331 ? A HIS 136 48 8 Y 1 A HIS 332 ? A HIS 137 49 9 Y 1 A HIS 327 ? A HIS 132 50 9 Y 1 A HIS 328 ? A HIS 133 51 9 Y 1 A HIS 329 ? A HIS 134 52 9 Y 1 A HIS 330 ? A HIS 135 53 9 Y 1 A HIS 331 ? A HIS 136 54 9 Y 1 A HIS 332 ? A HIS 137 55 10 Y 1 A HIS 327 ? A HIS 132 56 10 Y 1 A HIS 328 ? A HIS 133 57 10 Y 1 A HIS 329 ? A HIS 134 58 10 Y 1 A HIS 330 ? A HIS 135 59 10 Y 1 A HIS 331 ? A HIS 136 60 10 Y 1 A HIS 332 ? A HIS 137 61 11 Y 1 A HIS 327 ? A HIS 132 62 11 Y 1 A HIS 328 ? A HIS 133 63 11 Y 1 A HIS 329 ? A HIS 134 64 11 Y 1 A HIS 330 ? A HIS 135 65 11 Y 1 A HIS 331 ? A HIS 136 66 11 Y 1 A HIS 332 ? A HIS 137 67 12 Y 1 A HIS 327 ? A HIS 132 68 12 Y 1 A HIS 328 ? A HIS 133 69 12 Y 1 A HIS 329 ? A HIS 134 70 12 Y 1 A HIS 330 ? A HIS 135 71 12 Y 1 A HIS 331 ? A HIS 136 72 12 Y 1 A HIS 332 ? A HIS 137 73 13 Y 1 A HIS 327 ? A HIS 132 74 13 Y 1 A HIS 328 ? A HIS 133 75 13 Y 1 A HIS 329 ? A HIS 134 76 13 Y 1 A HIS 330 ? A HIS 135 77 13 Y 1 A HIS 331 ? A HIS 136 78 13 Y 1 A HIS 332 ? A HIS 137 79 14 Y 1 A HIS 327 ? A HIS 132 80 14 Y 1 A HIS 328 ? A HIS 133 81 14 Y 1 A HIS 329 ? A HIS 134 82 14 Y 1 A HIS 330 ? A HIS 135 83 14 Y 1 A HIS 331 ? A HIS 136 84 14 Y 1 A HIS 332 ? A HIS 137 85 15 Y 1 A HIS 327 ? A HIS 132 86 15 Y 1 A HIS 328 ? A HIS 133 87 15 Y 1 A HIS 329 ? A HIS 134 88 15 Y 1 A HIS 330 ? A HIS 135 89 15 Y 1 A HIS 331 ? A HIS 136 90 15 Y 1 A HIS 332 ? A HIS 137 91 16 Y 1 A HIS 327 ? A HIS 132 92 16 Y 1 A HIS 328 ? A HIS 133 93 16 Y 1 A HIS 329 ? A HIS 134 94 16 Y 1 A HIS 330 ? A HIS 135 95 16 Y 1 A HIS 331 ? A HIS 136 96 16 Y 1 A HIS 332 ? A HIS 137 97 17 Y 1 A HIS 327 ? A HIS 132 98 17 Y 1 A HIS 328 ? A HIS 133 99 17 Y 1 A HIS 329 ? A HIS 134 100 17 Y 1 A HIS 330 ? A HIS 135 101 17 Y 1 A HIS 331 ? A HIS 136 102 17 Y 1 A HIS 332 ? A HIS 137 103 18 Y 1 A HIS 327 ? A HIS 132 104 18 Y 1 A HIS 328 ? A HIS 133 105 18 Y 1 A HIS 329 ? A HIS 134 106 18 Y 1 A HIS 330 ? A HIS 135 107 18 Y 1 A HIS 331 ? A HIS 136 108 18 Y 1 A HIS 332 ? A HIS 137 109 19 Y 1 A HIS 327 ? A HIS 132 110 19 Y 1 A HIS 328 ? A HIS 133 111 19 Y 1 A HIS 329 ? A HIS 134 112 19 Y 1 A HIS 330 ? A HIS 135 113 19 Y 1 A HIS 331 ? A HIS 136 114 19 Y 1 A HIS 332 ? A HIS 137 115 20 Y 1 A HIS 327 ? A HIS 132 116 20 Y 1 A HIS 328 ? A HIS 133 117 20 Y 1 A HIS 329 ? A HIS 134 118 20 Y 1 A HIS 330 ? A HIS 135 119 20 Y 1 A HIS 331 ? A HIS 136 120 20 Y 1 A HIS 332 ? A HIS 137 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TYR N N N N 298 TYR CA C N S 299 TYR C C N N 300 TYR O O N N 301 TYR CB C N N 302 TYR CG C Y N 303 TYR CD1 C Y N 304 TYR CD2 C Y N 305 TYR CE1 C Y N 306 TYR CE2 C Y N 307 TYR CZ C Y N 308 TYR OH O N N 309 TYR OXT O N N 310 TYR H H N N 311 TYR H2 H N N 312 TYR HA H N N 313 TYR HB2 H N N 314 TYR HB3 H N N 315 TYR HD1 H N N 316 TYR HD2 H N N 317 TYR HE1 H N N 318 TYR HE2 H N N 319 TYR HH H N N 320 TYR HXT H N N 321 VAL N N N N 322 VAL CA C N S 323 VAL C C N N 324 VAL O O N N 325 VAL CB C N N 326 VAL CG1 C N N 327 VAL CG2 C N N 328 VAL OXT O N N 329 VAL H H N N 330 VAL H2 H N N 331 VAL HA H N N 332 VAL HB H N N 333 VAL HG11 H N N 334 VAL HG12 H N N 335 VAL HG13 H N N 336 VAL HG21 H N N 337 VAL HG22 H N N 338 VAL HG23 H N N 339 VAL HXT H N N 340 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TYR N CA sing N N 285 TYR N H sing N N 286 TYR N H2 sing N N 287 TYR CA C sing N N 288 TYR CA CB sing N N 289 TYR CA HA sing N N 290 TYR C O doub N N 291 TYR C OXT sing N N 292 TYR CB CG sing N N 293 TYR CB HB2 sing N N 294 TYR CB HB3 sing N N 295 TYR CG CD1 doub Y N 296 TYR CG CD2 sing Y N 297 TYR CD1 CE1 sing Y N 298 TYR CD1 HD1 sing N N 299 TYR CD2 CE2 doub Y N 300 TYR CD2 HD2 sing N N 301 TYR CE1 CZ doub Y N 302 TYR CE1 HE1 sing N N 303 TYR CE2 CZ sing Y N 304 TYR CE2 HE2 sing N N 305 TYR CZ OH sing N N 306 TYR OH HH sing N N 307 TYR OXT HXT sing N N 308 VAL N CA sing N N 309 VAL N H sing N N 310 VAL N H2 sing N N 311 VAL CA C sing N N 312 VAL CA CB sing N N 313 VAL CA HA sing N N 314 VAL C O doub N N 315 VAL C OXT sing N N 316 VAL CB CG1 sing N N 317 VAL CB CG2 sing N N 318 VAL CB HB sing N N 319 VAL CG1 HG11 sing N N 320 VAL CG1 HG12 sing N N 321 VAL CG1 HG13 sing N N 322 VAL CG2 HG21 sing N N 323 VAL CG2 HG22 sing N N 324 VAL CG2 HG23 sing N N 325 VAL OXT HXT sing N N 326 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2LCA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #