data_2LCE # _entry.id 2LCE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LCE pdb_00002lce 10.2210/pdb2lce/pdb RCSB RCSB102224 ? ? BMRB 17609 ? 10.13018/BMR17609 WWPDB D_1000102224 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-05-18 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-02-22 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 4 'Structure model' '_struct_ref_seq_dif.details' 25 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 26 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 27 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 28 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LCE _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-04-28 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17609 BMRB unspecified . Hr4436B TargetDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lee, H.' 1 'Shastry, R.' 2 'Ciccosanti, C.' 3 'Janjua, H.' 4 'Acton, T.B.' 5 'Xiao, R.' 6 'Everett, J.K.' 7 'Montelione, G.T.' 8 'Prestegard, J.H.' 9 'Northeast Structural Genomics Consortium (NESG)' 10 # _citation.id primary _citation.title 'Solution Structure of Hr4436B.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, H.' 1 ? primary 'Montelione, G.T.' 2 ? primary 'Prestegard, J.H.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'B-cell lymphoma 6 protein' 8639.782 1 ? ? 'C2H2-type Zinc fingers 2 and 3' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BCL-6, B-cell lymphoma 5 protein, BCL-5, Protein LAZ-3, Zinc finger and BTB domain-containing protein 27, Zinc finger protein 51' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGHHHHHHSHMTHSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPY _entity_poly.pdbx_seq_one_letter_code_can MGHHHHHHSHMTHSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier Hr4436B # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 HIS n 1 11 MET n 1 12 THR n 1 13 HIS n 1 14 SER n 1 15 ASP n 1 16 LYS n 1 17 PRO n 1 18 TYR n 1 19 LYS n 1 20 CYS n 1 21 ASP n 1 22 ARG n 1 23 CYS n 1 24 GLN n 1 25 ALA n 1 26 SER n 1 27 PHE n 1 28 ARG n 1 29 TYR n 1 30 LYS n 1 31 GLY n 1 32 ASN n 1 33 LEU n 1 34 ALA n 1 35 SER n 1 36 HIS n 1 37 LYS n 1 38 THR n 1 39 VAL n 1 40 HIS n 1 41 THR n 1 42 GLY n 1 43 GLU n 1 44 LYS n 1 45 PRO n 1 46 TYR n 1 47 ARG n 1 48 CYS n 1 49 ASN n 1 50 ILE n 1 51 CYS n 1 52 GLY n 1 53 ALA n 1 54 GLN n 1 55 PHE n 1 56 ASN n 1 57 ARG n 1 58 PRO n 1 59 ALA n 1 60 ASN n 1 61 LEU n 1 62 LYS n 1 63 THR n 1 64 HIS n 1 65 THR n 1 66 ARG n 1 67 ILE n 1 68 HIS n 1 69 SER n 1 70 GLY n 1 71 GLU n 1 72 LYS n 1 73 PRO n 1 74 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BCL6, BCL5, LAZ3, ZBTB27, ZNF51' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET 14-15C' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 HIS 10 10 ? ? ? A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 TYR 74 74 74 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 200 200 ZN ZN A . C 2 ZN 1 300 300 ZN ZN A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;The NESG target Hr4436B contains two C2H2 zinc finger motifs between residues 539 and 601 of the Homo sapiens B-cell lymphoma 6 protein. Correlation time measurements using cross-correlation based NMR spin relaxation experiments suggest that the two zinc finger motifs are connected by a flexible loop and not restricted with respect to one another. Therefore the positions of domains with respect to one another in the structures reported are not significant. ; _exptl.entry_id 2LCE _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LCE _struct.title 'Chemical shift assignment of Hr4436B from Homo Sapiens, Northeast Structural Genomics Consortium' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LCE _struct_keywords.pdbx_keywords 'Transcription regulator' _struct_keywords.text ;Structural Genomics, Northeast Structural Genomics Consortium, NESG, PSI-Biology, Protein Structure Initiative, Transcription regulator ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BCL6_HUMAN _struct_ref.pdbx_db_accession P41182 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code THSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPY _struct_ref.pdbx_align_begin 540 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LCE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 12 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 74 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P41182 _struct_ref_seq.db_align_beg 540 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 602 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 12 _struct_ref_seq.pdbx_auth_seq_align_end 74 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LCE MET A 1 ? UNP P41182 ? ? 'expression tag' 1 1 1 2LCE GLY A 2 ? UNP P41182 ? ? 'expression tag' 2 2 1 2LCE HIS A 3 ? UNP P41182 ? ? 'expression tag' 3 3 1 2LCE HIS A 4 ? UNP P41182 ? ? 'expression tag' 4 4 1 2LCE HIS A 5 ? UNP P41182 ? ? 'expression tag' 5 5 1 2LCE HIS A 6 ? UNP P41182 ? ? 'expression tag' 6 6 1 2LCE HIS A 7 ? UNP P41182 ? ? 'expression tag' 7 7 1 2LCE HIS A 8 ? UNP P41182 ? ? 'expression tag' 8 8 1 2LCE SER A 9 ? UNP P41182 ? ? 'expression tag' 9 9 1 2LCE HIS A 10 ? UNP P41182 ? ? 'expression tag' 10 10 1 2LCE MET A 11 ? UNP P41182 ? ? 'expression tag' 11 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 29 ? THR A 41 ? TYR A 29 THR A 41 1 ? 13 HELX_P HELX_P2 2 ARG A 57 ? SER A 69 ? ARG A 57 SER A 69 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 20 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 20 A ZN 200 1_555 ? ? ? ? ? ? ? 2.362 ? ? metalc2 metalc ? ? A CYS 23 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 23 A ZN 200 1_555 ? ? ? ? ? ? ? 2.360 ? ? metalc3 metalc ? ? A HIS 36 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 36 A ZN 200 1_555 ? ? ? ? ? ? ? 2.155 ? ? metalc4 metalc ? ? A HIS 40 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 40 A ZN 200 1_555 ? ? ? ? ? ? ? 2.150 ? ? metalc5 metalc ? ? A CYS 48 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 48 A ZN 300 1_555 ? ? ? ? ? ? ? 2.362 ? ? metalc6 metalc ? ? A CYS 51 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 51 A ZN 300 1_555 ? ? ? ? ? ? ? 2.362 ? ? metalc7 metalc ? ? A HIS 64 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 64 A ZN 300 1_555 ? ? ? ? ? ? ? 2.153 ? ? metalc8 metalc ? ? A HIS 68 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 68 A ZN 300 1_555 ? ? ? ? ? ? ? 2.153 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 20 ? A CYS 20 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 23 ? A CYS 23 ? 1_555 111.4 ? 2 SG ? A CYS 20 ? A CYS 20 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 36 ? A HIS 36 ? 1_555 108.3 ? 3 SG ? A CYS 23 ? A CYS 23 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 36 ? A HIS 36 ? 1_555 102.7 ? 4 SG ? A CYS 20 ? A CYS 20 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 40 ? A HIS 40 ? 1_555 114.2 ? 5 SG ? A CYS 23 ? A CYS 23 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 40 ? A HIS 40 ? 1_555 114.8 ? 6 NE2 ? A HIS 36 ? A HIS 36 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 40 ? A HIS 40 ? 1_555 104.4 ? 7 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 109.7 ? 8 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 NE2 ? A HIS 64 ? A HIS 64 ? 1_555 111.2 ? 9 SG ? A CYS 51 ? A CYS 51 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 NE2 ? A HIS 64 ? A HIS 64 ? 1_555 114.7 ? 10 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 112.8 ? 11 SG ? A CYS 51 ? A CYS 51 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 111.9 ? 12 NE2 ? A HIS 64 ? A HIS 64 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 96.0 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 46 ? ARG A 47 ? TYR A 46 ARG A 47 A 2 GLN A 54 ? PHE A 55 ? GLN A 54 PHE A 55 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 46 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 46 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 55 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 55 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 200 ? 4 'BINDING SITE FOR RESIDUE ZN A 200' AC2 Software A ZN 300 ? 4 'BINDING SITE FOR RESIDUE ZN A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 20 ? CYS A 20 . ? 1_555 ? 2 AC1 4 CYS A 23 ? CYS A 23 . ? 1_555 ? 3 AC1 4 HIS A 36 ? HIS A 36 . ? 1_555 ? 4 AC1 4 HIS A 40 ? HIS A 40 . ? 1_555 ? 5 AC2 4 CYS A 48 ? CYS A 48 . ? 1_555 ? 6 AC2 4 CYS A 51 ? CYS A 51 . ? 1_555 ? 7 AC2 4 HIS A 64 ? HIS A 64 . ? 1_555 ? 8 AC2 4 HIS A 68 ? HIS A 68 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 2 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LEU _pdbx_validate_close_contact.auth_seq_id_1 61 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 THR _pdbx_validate_close_contact.auth_seq_id_2 65 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 14 ? ? -168.39 106.01 2 1 ASP A 15 ? ? -148.05 20.70 3 1 ASP A 21 ? ? -76.76 49.03 4 1 ARG A 22 ? ? -142.22 -32.39 5 1 THR A 41 ? ? 50.64 78.07 6 1 GLU A 43 ? ? -75.95 42.40 7 1 SER A 69 ? ? -57.13 90.49 8 1 GLU A 71 ? ? -167.74 1.07 9 1 LYS A 72 ? ? -165.98 72.80 10 2 ASP A 15 ? ? -81.59 36.85 11 2 ALA A 25 ? ? -45.18 157.11 12 2 LYS A 44 ? ? 56.22 71.92 13 2 CYS A 51 ? ? -103.34 -66.44 14 3 ALA A 25 ? ? -46.10 172.80 15 3 LYS A 44 ? ? -167.23 62.48 16 3 PRO A 45 ? ? -38.42 84.87 17 3 CYS A 51 ? ? -102.86 -72.13 18 3 LYS A 72 ? ? 53.61 73.15 19 4 CYS A 23 ? ? -115.84 -164.95 20 4 ALA A 25 ? ? -52.88 175.00 21 4 LYS A 44 ? ? -169.97 51.06 22 4 PRO A 45 ? ? -65.50 -157.31 23 4 ALA A 53 ? ? -51.62 -177.40 24 5 HIS A 13 ? ? -153.55 -127.90 25 5 SER A 14 ? ? 57.21 153.75 26 5 ASP A 15 ? ? -76.32 35.68 27 5 CYS A 23 ? ? -108.81 -141.63 28 5 ALA A 25 ? ? -46.51 98.10 29 5 GLU A 43 ? ? 53.57 107.39 30 5 LYS A 44 ? ? -159.14 71.73 31 5 CYS A 51 ? ? -113.83 -70.53 32 5 GLU A 71 ? ? 59.32 159.50 33 6 PRO A 45 ? ? -75.86 -97.52 34 6 CYS A 51 ? ? -123.17 -61.86 35 6 HIS A 68 ? ? -66.75 24.85 36 6 LYS A 72 ? ? -169.96 54.54 37 7 HIS A 13 ? ? 48.25 85.39 38 7 SER A 14 ? ? -165.09 14.34 39 7 GLU A 43 ? ? -162.44 4.23 40 7 LYS A 44 ? ? 60.21 62.34 41 7 PRO A 45 ? ? -75.44 -97.56 42 7 ALA A 53 ? ? -54.22 173.45 43 7 THR A 65 ? ? -48.57 -18.14 44 7 LYS A 72 ? ? -169.42 50.99 45 8 THR A 12 ? ? 59.57 -76.77 46 8 THR A 41 ? ? 57.22 114.49 47 8 PRO A 45 ? ? -68.66 -92.84 48 8 CYS A 51 ? ? -115.76 -70.54 49 8 LYS A 72 ? ? -162.51 73.77 50 9 SER A 14 ? ? -154.21 37.93 51 9 ALA A 25 ? ? -68.07 -178.09 52 9 LYS A 72 ? ? 53.98 73.05 53 10 LYS A 44 ? ? 36.82 72.08 54 10 CYS A 51 ? ? -109.21 -71.93 55 10 GLU A 71 ? ? -170.66 34.02 56 10 LYS A 72 ? ? -141.07 53.63 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LCE _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LCE _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.8 mM [U-100% 13C; U-100% 15N] Hr4436B, 2 % sodium azide, 10 mM DTT, 50 uM ZnSo4, 50 uM DSS, 100 mM sodium chloride, 20 mM MES, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;0.65 mM [U-100% 15N] Hr4436B, 2 % sodium azide, 10 mM DTT, 50 uM ZnSo4, 50 uM DSS, 100 mM sodium chloride, 20 mM MES, 4.2 % C12E5 PEG/Hexanol, 95% H2O/5% D2O ; 2 '95% H2O/5% D2O' ;0.8 mM [U-100% 13C; U-100% 15N] Hr4436B, 2 % sodium azide, 10 mM DTT, 50 uM ZnSo4, 50 uM DSS, 100 mM sodium chloride, 20 mM MES, 5 % Positively Charged Stretch Polyacrylamide Gel, 95% H2O/5% D2O ; 3 '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Hr4436B-1 0.8 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium azide-2' 2 ? % ? 1 DTT-3 10 ? mM ? 1 ZnSo4-4 50 ? uM ? 1 DSS-5 50 ? uM ? 1 'sodium chloride-6' 100 ? mM ? 1 MES-7 20 ? mM ? 1 Hr4436B-8 0.65 ? mM '[U-100% 15N]' 2 'sodium azide-9' 2 ? % ? 2 DTT-10 10 ? mM ? 2 ZnSo4-11 50 ? uM ? 2 DSS-12 50 ? uM ? 2 'sodium chloride-13' 100 ? mM ? 2 MES-14 20 ? mM ? 2 'C12E5 PEG/Hexanol-15' 4.2 ? % ? 2 Hr4436B-16 0.8 ? mM '[U-100% 13C; U-100% 15N]' 3 'sodium azide-17' 2 ? % ? 3 DTT-18 10 ? mM ? 3 ZnSo4-19 50 ? uM ? 3 DSS-20 50 ? uM ? 3 'sodium chloride-21' 100 ? mM ? 3 MES-22 20 ? mM ? 3 'Positively Charged Stretch Polyacrylamide Gel-23' 5 ? % ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D C(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCACB' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY aliphatic' 1 10 1 '3D 1H-13C NOESY aromatic' 1 11 2 '2D NH J-modulation' 1 12 3 '2D NH J-modulation' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LCE _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 545 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2LCE _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 2.18 3 'Bhattacharya and Montelione' 'data analysis' PSVS ? 4 Goddard 'peak picking' Sparky ? 5 Goddard 'chemical shift assignment' Sparky ? 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A HIS 10 ? A HIS 10 11 2 Y 1 A MET 1 ? A MET 1 12 2 Y 1 A GLY 2 ? A GLY 2 13 2 Y 1 A HIS 3 ? A HIS 3 14 2 Y 1 A HIS 4 ? A HIS 4 15 2 Y 1 A HIS 5 ? A HIS 5 16 2 Y 1 A HIS 6 ? A HIS 6 17 2 Y 1 A HIS 7 ? A HIS 7 18 2 Y 1 A HIS 8 ? A HIS 8 19 2 Y 1 A SER 9 ? A SER 9 20 2 Y 1 A HIS 10 ? A HIS 10 21 3 Y 1 A MET 1 ? A MET 1 22 3 Y 1 A GLY 2 ? A GLY 2 23 3 Y 1 A HIS 3 ? A HIS 3 24 3 Y 1 A HIS 4 ? A HIS 4 25 3 Y 1 A HIS 5 ? A HIS 5 26 3 Y 1 A HIS 6 ? A HIS 6 27 3 Y 1 A HIS 7 ? A HIS 7 28 3 Y 1 A HIS 8 ? A HIS 8 29 3 Y 1 A SER 9 ? A SER 9 30 3 Y 1 A HIS 10 ? A HIS 10 31 4 Y 1 A MET 1 ? A MET 1 32 4 Y 1 A GLY 2 ? A GLY 2 33 4 Y 1 A HIS 3 ? A HIS 3 34 4 Y 1 A HIS 4 ? A HIS 4 35 4 Y 1 A HIS 5 ? A HIS 5 36 4 Y 1 A HIS 6 ? A HIS 6 37 4 Y 1 A HIS 7 ? A HIS 7 38 4 Y 1 A HIS 8 ? A HIS 8 39 4 Y 1 A SER 9 ? A SER 9 40 4 Y 1 A HIS 10 ? A HIS 10 41 5 Y 1 A MET 1 ? A MET 1 42 5 Y 1 A GLY 2 ? A GLY 2 43 5 Y 1 A HIS 3 ? A HIS 3 44 5 Y 1 A HIS 4 ? A HIS 4 45 5 Y 1 A HIS 5 ? A HIS 5 46 5 Y 1 A HIS 6 ? A HIS 6 47 5 Y 1 A HIS 7 ? A HIS 7 48 5 Y 1 A HIS 8 ? A HIS 8 49 5 Y 1 A SER 9 ? A SER 9 50 5 Y 1 A HIS 10 ? A HIS 10 51 6 Y 1 A MET 1 ? A MET 1 52 6 Y 1 A GLY 2 ? A GLY 2 53 6 Y 1 A HIS 3 ? A HIS 3 54 6 Y 1 A HIS 4 ? A HIS 4 55 6 Y 1 A HIS 5 ? A HIS 5 56 6 Y 1 A HIS 6 ? A HIS 6 57 6 Y 1 A HIS 7 ? A HIS 7 58 6 Y 1 A HIS 8 ? A HIS 8 59 6 Y 1 A SER 9 ? A SER 9 60 6 Y 1 A HIS 10 ? A HIS 10 61 7 Y 1 A MET 1 ? A MET 1 62 7 Y 1 A GLY 2 ? A GLY 2 63 7 Y 1 A HIS 3 ? A HIS 3 64 7 Y 1 A HIS 4 ? A HIS 4 65 7 Y 1 A HIS 5 ? A HIS 5 66 7 Y 1 A HIS 6 ? A HIS 6 67 7 Y 1 A HIS 7 ? A HIS 7 68 7 Y 1 A HIS 8 ? A HIS 8 69 7 Y 1 A SER 9 ? A SER 9 70 7 Y 1 A HIS 10 ? A HIS 10 71 8 Y 1 A MET 1 ? A MET 1 72 8 Y 1 A GLY 2 ? A GLY 2 73 8 Y 1 A HIS 3 ? A HIS 3 74 8 Y 1 A HIS 4 ? A HIS 4 75 8 Y 1 A HIS 5 ? A HIS 5 76 8 Y 1 A HIS 6 ? A HIS 6 77 8 Y 1 A HIS 7 ? A HIS 7 78 8 Y 1 A HIS 8 ? A HIS 8 79 8 Y 1 A SER 9 ? A SER 9 80 8 Y 1 A HIS 10 ? A HIS 10 81 9 Y 1 A MET 1 ? A MET 1 82 9 Y 1 A GLY 2 ? A GLY 2 83 9 Y 1 A HIS 3 ? A HIS 3 84 9 Y 1 A HIS 4 ? A HIS 4 85 9 Y 1 A HIS 5 ? A HIS 5 86 9 Y 1 A HIS 6 ? A HIS 6 87 9 Y 1 A HIS 7 ? A HIS 7 88 9 Y 1 A HIS 8 ? A HIS 8 89 9 Y 1 A SER 9 ? A SER 9 90 9 Y 1 A HIS 10 ? A HIS 10 91 10 Y 1 A MET 1 ? A MET 1 92 10 Y 1 A GLY 2 ? A GLY 2 93 10 Y 1 A HIS 3 ? A HIS 3 94 10 Y 1 A HIS 4 ? A HIS 4 95 10 Y 1 A HIS 5 ? A HIS 5 96 10 Y 1 A HIS 6 ? A HIS 6 97 10 Y 1 A HIS 7 ? A HIS 7 98 10 Y 1 A HIS 8 ? A HIS 8 99 10 Y 1 A SER 9 ? A SER 9 100 10 Y 1 A HIS 10 ? A HIS 10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 ZN ZN ZN N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _atom_sites.entry_id 2LCE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_