data_2LCZ # _entry.id 2LCZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LCZ pdb_00002lcz 10.2210/pdb2lcz/pdb RCSB RCSB102245 ? ? BMRB 17639 ? ? WWPDB D_1000102245 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17639 BMRB unspecified . 2LCY PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LCZ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-05-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gregory, S.M.' 1 'Harada, E.' 2 'Liang, B.' 3 'Tamm, L.K.' 4 # _citation.id primary _citation.title 'Structure and function of the complete internal fusion loop from Ebolavirus glycoprotein 2.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 108 _citation.page_first 11211 _citation.page_last 11216 _citation.year 2011 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21690393 _citation.pdbx_database_id_DOI 10.1073/pnas.1104760108 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gregory, S.M.' 1 ? primary 'Harada, E.' 2 ? primary 'Liang, B.' 3 ? primary 'Delos, S.E.' 4 ? primary 'White, J.M.' 5 ? primary 'Tamm, L.K.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Virion spike glycoprotein' _entity.formula_weight 5947.692 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues 507-560' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQ _entity_poly.pdbx_seq_one_letter_code_can AQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLN n 1 3 PRO n 1 4 LYS n 1 5 CYS n 1 6 ASN n 1 7 PRO n 1 8 ASN n 1 9 LEU n 1 10 HIS n 1 11 TYR n 1 12 TRP n 1 13 THR n 1 14 THR n 1 15 GLN n 1 16 ASP n 1 17 GLU n 1 18 GLY n 1 19 ALA n 1 20 ALA n 1 21 ILE n 1 22 GLY n 1 23 LEU n 1 24 ALA n 1 25 TRP n 1 26 ILE n 1 27 PRO n 1 28 TYR n 1 29 PHE n 1 30 GLY n 1 31 PRO n 1 32 ALA n 1 33 ALA n 1 34 GLU n 1 35 GLY n 1 36 ILE n 1 37 TYR n 1 38 ILE n 1 39 GLU n 1 40 GLY n 1 41 LEU n 1 42 MET n 1 43 HIS n 1 44 ASN n 1 45 GLN n 1 46 ASP n 1 47 GLY n 1 48 LEU n 1 49 ILE n 1 50 CYS n 1 51 GLY n 1 52 LEU n 1 53 ARG n 1 54 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene GP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Zaire ebolavirus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 186538 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET41 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A9QPL9_9MONO _struct_ref.pdbx_db_accession A9QPL9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQ _struct_ref.pdbx_align_begin 507 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LCZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 54 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A9QPL9 _struct_ref_seq.db_align_beg 507 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 560 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 507 _struct_ref_seq.pdbx_auth_seq_align_end 560 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 1 '3D HNCA' 1 5 1 '3D HN(CO)CA' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D HNCACB' 1 8 1 '3D HNCO' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '3D 1H-13C NOESY' 1 11 1 '3D 1H-13C NOESY aliphatic' 1 12 1 '3D 1H-13C NOESY aromatic' 1 13 1 '3D HNHA' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5-1 mM [U-13C; U-15N] Ebolavirus Fusion Loop pH 7.0, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.5-1 mM [U-15N] Ebolavirus Fusion Loop pH 7.0, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker DRX 1 'Bruker DRX' 600 Bruker DRX 2 'Bruker DRX' 600 Varian NMRS 3 'Varian NMRS' # _pdbx_nmr_refine.entry_id 2LCZ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria '20 structures for lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LCZ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LCZ _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_software.authors 'Brunger A. T. et.al.' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CNS _pdbx_nmr_software.version ? _pdbx_nmr_software.ordinal 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LCZ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LCZ _struct.title 'NMR Structure of the Complete Internal Fusion Loop from Ebolavirus GP2 at pH 7.0' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LCZ _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 5 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 50 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 511 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 556 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.030 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 2LCZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 507 507 ALA ALA A . n A 1 2 GLN 2 508 508 GLN GLN A . n A 1 3 PRO 3 509 509 PRO PRO A . n A 1 4 LYS 4 510 510 LYS LYS A . n A 1 5 CYS 5 511 511 CYS CYS A . n A 1 6 ASN 6 512 512 ASN ASN A . n A 1 7 PRO 7 513 513 PRO PRO A . n A 1 8 ASN 8 514 514 ASN ASN A . n A 1 9 LEU 9 515 515 LEU LEU A . n A 1 10 HIS 10 516 516 HIS HIS A . n A 1 11 TYR 11 517 517 TYR TYR A . n A 1 12 TRP 12 518 518 TRP TRP A . n A 1 13 THR 13 519 519 THR THR A . n A 1 14 THR 14 520 520 THR THR A . n A 1 15 GLN 15 521 521 GLN GLN A . n A 1 16 ASP 16 522 522 ASP ASP A . n A 1 17 GLU 17 523 523 GLU GLU A . n A 1 18 GLY 18 524 524 GLY GLY A . n A 1 19 ALA 19 525 525 ALA ALA A . n A 1 20 ALA 20 526 526 ALA ALA A . n A 1 21 ILE 21 527 527 ILE ILE A . n A 1 22 GLY 22 528 528 GLY GLY A . n A 1 23 LEU 23 529 529 LEU LEU A . n A 1 24 ALA 24 530 530 ALA ALA A . n A 1 25 TRP 25 531 531 TRP TRP A . n A 1 26 ILE 26 532 532 ILE ILE A . n A 1 27 PRO 27 533 533 PRO PRO A . n A 1 28 TYR 28 534 534 TYR TYR A . n A 1 29 PHE 29 535 535 PHE PHE A . n A 1 30 GLY 30 536 536 GLY GLY A . n A 1 31 PRO 31 537 537 PRO PRO A . n A 1 32 ALA 32 538 538 ALA ALA A . n A 1 33 ALA 33 539 539 ALA ALA A . n A 1 34 GLU 34 540 540 GLU GLU A . n A 1 35 GLY 35 541 541 GLY GLY A . n A 1 36 ILE 36 542 542 ILE ILE A . n A 1 37 TYR 37 543 543 TYR TYR A . n A 1 38 ILE 38 544 544 ILE ILE A . n A 1 39 GLU 39 545 545 GLU GLU A . n A 1 40 GLY 40 546 546 GLY GLY A . n A 1 41 LEU 41 547 547 LEU LEU A . n A 1 42 MET 42 548 548 MET MET A . n A 1 43 HIS 43 549 549 HIS HIS A . n A 1 44 ASN 44 550 550 ASN ASN A . n A 1 45 GLN 45 551 551 GLN GLN A . n A 1 46 ASP 46 552 552 ASP ASP A . n A 1 47 GLY 47 553 553 GLY GLY A . n A 1 48 LEU 48 554 554 LEU LEU A . n A 1 49 ILE 49 555 555 ILE ILE A . n A 1 50 CYS 50 556 556 CYS CYS A . n A 1 51 GLY 51 557 557 GLY GLY A . n A 1 52 LEU 52 558 558 LEU LEU A . n A 1 53 ARG 53 559 559 ARG ARG A . n A 1 54 GLN 54 560 560 GLN GLN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-06-22 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2011-07-20 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Ebolavirus Fusion Loop pH 7.0-1' ? 0.5-1 mM '[U-13C; U-15N]' 1 'Ebolavirus Fusion Loop pH 7.0-2' ? 0.5-1 mM '[U-15N]' 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A TYR 517 ? ? H A THR 519 ? ? 1.38 2 5 O A TYR 517 ? ? H A THR 520 ? ? 1.53 3 5 O A TYR 517 ? ? N A THR 519 ? ? 1.96 4 7 O A TYR 543 ? ? N A GLU 545 ? ? 2.12 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 508 ? ? -171.12 64.24 2 1 PRO A 509 ? ? -59.79 173.36 3 1 CYS A 511 ? ? 60.32 101.29 4 1 ASN A 514 ? ? -118.80 51.18 5 1 LEU A 515 ? ? -105.59 -67.37 6 1 HIS A 516 ? ? -161.51 -57.05 7 1 TYR A 517 ? ? -55.94 -9.61 8 1 GLN A 521 ? ? -99.99 -157.64 9 1 LEU A 529 ? ? 78.00 -51.61 10 1 ALA A 530 ? ? -78.67 47.13 11 1 TYR A 534 ? ? -177.16 -21.06 12 1 GLU A 540 ? ? -141.57 -41.64 13 1 ILE A 542 ? ? -148.26 -35.40 14 1 ILE A 544 ? ? 30.84 -71.00 15 1 GLU A 545 ? ? 69.63 91.85 16 1 MET A 548 ? ? -63.13 80.09 17 1 ASP A 552 ? ? 179.17 31.09 18 1 ILE A 555 ? ? -144.03 -42.99 19 1 CYS A 556 ? ? -113.61 60.55 20 1 LEU A 558 ? ? -146.38 -46.07 21 1 ARG A 559 ? ? 175.59 37.88 22 2 GLN A 508 ? ? -165.68 53.97 23 2 CYS A 511 ? ? 51.32 91.28 24 2 LEU A 515 ? ? -117.18 -72.83 25 2 HIS A 516 ? ? -147.62 -56.04 26 2 TRP A 518 ? ? 62.79 -44.99 27 2 THR A 520 ? ? -85.16 -78.45 28 2 GLN A 521 ? ? -100.51 -161.88 29 2 GLU A 523 ? ? 48.31 75.84 30 2 ILE A 527 ? ? -133.81 -48.23 31 2 LEU A 529 ? ? 70.04 -56.37 32 2 ALA A 530 ? ? -79.48 46.23 33 2 TYR A 534 ? ? -155.33 6.26 34 2 GLU A 540 ? ? -163.69 -42.81 35 2 ILE A 542 ? ? -148.42 -29.99 36 2 ILE A 544 ? ? 36.85 -74.29 37 2 GLU A 545 ? ? 68.32 85.82 38 2 HIS A 549 ? ? -116.36 -74.63 39 2 ASN A 550 ? ? 175.47 73.17 40 2 GLN A 551 ? ? -99.11 -78.25 41 2 ILE A 555 ? ? -148.30 -42.16 42 2 LEU A 558 ? ? -141.67 -40.47 43 2 ARG A 559 ? ? 173.74 32.67 44 3 GLN A 508 ? ? -172.38 56.49 45 3 CYS A 511 ? ? 61.76 114.84 46 3 ASN A 514 ? ? -118.62 53.18 47 3 LEU A 515 ? ? -121.98 -62.73 48 3 HIS A 516 ? ? -171.18 -56.00 49 3 GLN A 521 ? ? -100.45 -157.58 50 3 ALA A 525 ? ? 52.89 11.00 51 3 ALA A 526 ? ? 46.69 16.12 52 3 LEU A 529 ? ? 67.91 -53.96 53 3 TYR A 534 ? ? -157.97 6.45 54 3 ALA A 539 ? ? -53.10 -75.87 55 3 GLU A 540 ? ? 75.87 -43.59 56 3 ILE A 542 ? ? -151.09 -33.20 57 3 ILE A 544 ? ? 36.47 -73.44 58 3 ASN A 550 ? ? 168.59 63.17 59 3 ASP A 552 ? ? -179.20 -22.39 60 3 ILE A 555 ? ? -142.99 -41.56 61 3 CYS A 556 ? ? -101.41 72.16 62 3 LEU A 558 ? ? -134.32 -48.16 63 3 ARG A 559 ? ? 178.81 37.70 64 4 GLN A 508 ? ? -169.87 56.09 65 4 PRO A 509 ? ? -78.87 -165.94 66 4 CYS A 511 ? ? 60.67 90.92 67 4 HIS A 516 ? ? -177.59 -56.72 68 4 THR A 520 ? ? -93.19 -68.49 69 4 ILE A 527 ? ? -131.67 -46.57 70 4 LEU A 529 ? ? 69.04 -46.01 71 4 TYR A 534 ? ? -154.34 6.65 72 4 ILE A 542 ? ? -142.35 -6.19 73 4 ILE A 544 ? ? 34.45 -72.46 74 4 GLU A 545 ? ? 68.40 90.47 75 4 HIS A 549 ? ? -133.19 -68.70 76 4 ASN A 550 ? ? 167.44 66.66 77 4 GLN A 551 ? ? -88.70 -74.67 78 4 ILE A 555 ? ? -141.31 -40.98 79 4 LEU A 558 ? ? -144.44 -40.94 80 4 ARG A 559 ? ? 176.03 32.87 81 5 GLN A 508 ? ? -155.99 53.73 82 5 CYS A 511 ? ? 63.41 122.10 83 5 ASN A 514 ? ? -115.53 57.61 84 5 HIS A 516 ? ? -164.23 -84.63 85 5 TYR A 517 ? ? -52.21 -137.79 86 5 TRP A 518 ? ? 26.14 -63.17 87 5 GLN A 521 ? ? -100.79 -153.51 88 5 GLU A 523 ? ? 46.96 70.72 89 5 ALA A 525 ? ? 52.47 11.95 90 5 ALA A 526 ? ? 46.55 16.15 91 5 LEU A 529 ? ? 71.15 -34.79 92 5 TYR A 534 ? ? -159.00 -28.95 93 5 ILE A 542 ? ? -148.36 -28.19 94 5 ILE A 544 ? ? 34.44 -72.03 95 5 GLU A 545 ? ? 71.87 34.29 96 5 LEU A 547 ? ? -143.04 -4.11 97 5 ASN A 550 ? ? 59.56 101.42 98 5 GLN A 551 ? ? -133.43 -76.33 99 5 ILE A 555 ? ? -145.56 -42.55 100 5 LEU A 558 ? ? -138.67 -48.81 101 5 ARG A 559 ? ? 177.98 38.28 102 6 GLN A 508 ? ? -174.70 58.48 103 6 CYS A 511 ? ? 60.72 111.00 104 6 HIS A 516 ? ? -174.75 -54.47 105 6 GLN A 521 ? ? -100.44 -161.31 106 6 GLU A 523 ? ? 45.21 74.77 107 6 ALA A 525 ? ? 52.03 10.28 108 6 ALA A 526 ? ? 46.60 16.40 109 6 LEU A 529 ? ? 70.39 -38.48 110 6 TYR A 534 ? ? -156.31 6.08 111 6 ALA A 539 ? ? -51.73 -72.02 112 6 GLU A 540 ? ? 70.89 -48.23 113 6 ILE A 542 ? ? -146.62 -33.53 114 6 ILE A 544 ? ? 37.77 -73.38 115 6 GLU A 545 ? ? 66.86 85.07 116 6 MET A 548 ? ? -67.85 64.84 117 6 ASN A 550 ? ? 68.70 -66.29 118 6 GLN A 551 ? ? 49.53 -82.10 119 6 ILE A 555 ? ? -143.91 -42.65 120 6 LEU A 558 ? ? -134.96 -47.41 121 6 ARG A 559 ? ? 179.48 38.31 122 7 GLN A 508 ? ? -152.23 50.92 123 7 CYS A 511 ? ? 61.72 101.11 124 7 ASN A 514 ? ? -119.91 54.40 125 7 HIS A 516 ? ? -175.61 -52.76 126 7 THR A 520 ? ? -105.15 -67.12 127 7 ASP A 522 ? ? -94.73 34.70 128 7 ILE A 527 ? ? -124.75 -53.40 129 7 LEU A 529 ? ? 72.98 -20.74 130 7 TYR A 534 ? ? -150.82 6.45 131 7 ALA A 539 ? ? -46.25 164.21 132 7 GLU A 540 ? ? -147.11 -43.17 133 7 ILE A 544 ? ? 4.69 -51.04 134 7 GLU A 545 ? ? 44.44 79.18 135 7 MET A 548 ? ? -68.01 71.94 136 7 GLN A 551 ? ? -87.12 -70.94 137 7 ILE A 555 ? ? -147.52 -40.95 138 7 CYS A 556 ? ? -93.56 36.63 139 7 ARG A 559 ? ? 171.03 36.34 140 8 GLN A 508 ? ? -170.75 56.54 141 8 CYS A 511 ? ? 59.66 98.32 142 8 HIS A 516 ? ? -176.97 -56.69 143 8 GLN A 521 ? ? -100.46 -157.85 144 8 GLU A 523 ? ? 44.75 74.02 145 8 ALA A 525 ? ? 54.10 9.99 146 8 ALA A 526 ? ? 46.98 16.48 147 8 LEU A 529 ? ? 75.28 -21.40 148 8 ALA A 539 ? ? -48.84 -79.65 149 8 GLU A 540 ? ? 76.72 -44.96 150 8 ILE A 542 ? ? -151.06 -33.92 151 8 ILE A 544 ? ? 37.53 -73.39 152 8 GLU A 545 ? ? 66.05 86.09 153 8 MET A 548 ? ? -69.11 69.16 154 8 HIS A 549 ? ? -120.74 -53.18 155 8 ASN A 550 ? ? -179.11 -57.28 156 8 GLN A 551 ? ? 27.12 -91.84 157 8 ILE A 555 ? ? -141.49 -42.62 158 8 LEU A 558 ? ? -138.39 -48.07 159 8 ARG A 559 ? ? 177.56 38.25 160 9 GLN A 508 ? ? -155.07 52.80 161 9 CYS A 511 ? ? 60.78 107.42 162 9 ASN A 514 ? ? -118.35 51.99 163 9 HIS A 516 ? ? -174.93 -57.14 164 9 THR A 520 ? ? -93.84 -67.65 165 9 GLN A 521 ? ? -99.90 -156.82 166 9 ASP A 522 ? ? -98.35 34.51 167 9 ILE A 527 ? ? -124.27 -52.70 168 9 LEU A 529 ? ? 73.21 -25.60 169 9 GLU A 540 ? ? -153.50 -41.01 170 9 ILE A 542 ? ? -149.66 -31.84 171 9 ILE A 544 ? ? 42.09 -72.70 172 9 ASN A 550 ? ? 65.35 64.29 173 9 ASP A 552 ? ? -179.43 -22.42 174 9 ILE A 555 ? ? -145.28 -40.80 175 9 LEU A 558 ? ? -137.60 -48.23 176 9 ARG A 559 ? ? 178.27 38.43 177 10 GLN A 508 ? ? -158.34 64.94 178 10 CYS A 511 ? ? 56.76 99.81 179 10 HIS A 516 ? ? -176.89 -56.67 180 10 ALA A 525 ? ? 57.54 12.60 181 10 ALA A 526 ? ? 46.88 15.22 182 10 LEU A 529 ? ? 79.81 -27.91 183 10 GLU A 540 ? ? 70.78 -53.13 184 10 ILE A 542 ? ? -150.74 -30.79 185 10 ILE A 544 ? ? 40.65 -72.86 186 10 LEU A 547 ? ? -143.49 -8.89 187 10 ASN A 550 ? ? 62.49 87.16 188 10 GLN A 551 ? ? -115.71 -77.13 189 10 ILE A 555 ? ? -142.53 -42.05 190 10 LEU A 558 ? ? -142.66 -40.17 191 10 ARG A 559 ? ? 174.71 31.40 192 11 GLN A 508 ? ? -176.86 60.96 193 11 CYS A 511 ? ? 59.27 92.55 194 11 HIS A 516 ? ? -178.48 -56.94 195 11 THR A 520 ? ? -90.29 -60.98 196 11 GLN A 521 ? ? -100.39 -168.31 197 11 GLU A 523 ? ? 45.50 29.02 198 11 ALA A 525 ? ? 32.24 26.70 199 11 ALA A 526 ? ? 42.06 16.34 200 11 LEU A 529 ? ? 72.23 -18.01 201 11 GLU A 540 ? ? -133.37 -32.08 202 11 ILE A 542 ? ? -142.42 -31.63 203 11 ILE A 544 ? ? 33.27 -71.83 204 11 GLU A 545 ? ? 70.80 35.85 205 11 LEU A 547 ? ? -146.92 -5.52 206 11 ASN A 550 ? ? 60.79 89.00 207 11 GLN A 551 ? ? -119.52 -78.57 208 11 ILE A 555 ? ? -140.69 -42.61 209 11 LEU A 558 ? ? -135.79 -44.86 210 11 ARG A 559 ? ? 177.48 38.78 211 12 GLN A 508 ? ? -158.81 52.84 212 12 CYS A 511 ? ? 60.76 117.45 213 12 HIS A 516 ? ? -159.64 -55.20 214 12 TYR A 517 ? ? -54.92 -8.79 215 12 ALA A 525 ? ? 57.28 8.41 216 12 ALA A 526 ? ? 47.43 15.97 217 12 LEU A 529 ? ? 77.99 -18.40 218 12 GLU A 540 ? ? -134.31 -34.08 219 12 ILE A 542 ? ? -148.69 -36.00 220 12 ILE A 544 ? ? 32.31 -72.25 221 12 GLU A 545 ? ? 68.85 96.73 222 12 HIS A 549 ? ? -130.79 -48.83 223 12 ASN A 550 ? ? 167.73 -73.44 224 12 GLN A 551 ? ? 57.04 -152.28 225 12 ASP A 552 ? ? 110.49 21.59 226 12 ILE A 555 ? ? -147.10 -41.13 227 12 LEU A 558 ? ? -141.44 -44.81 228 12 ARG A 559 ? ? 170.38 35.78 229 13 GLN A 508 ? ? -174.56 66.94 230 13 CYS A 511 ? ? 57.94 98.65 231 13 HIS A 516 ? ? -176.63 -55.90 232 13 GLN A 521 ? ? -100.68 -162.32 233 13 GLU A 523 ? ? 43.90 73.93 234 13 ALA A 525 ? ? 53.77 11.08 235 13 ALA A 526 ? ? 47.11 16.23 236 13 LEU A 529 ? ? 69.29 -56.87 237 13 ALA A 530 ? ? -79.74 46.16 238 13 TYR A 534 ? ? -156.58 6.35 239 13 ILE A 542 ? ? -146.99 -33.51 240 13 ILE A 544 ? ? 36.96 -72.73 241 13 GLU A 545 ? ? 66.21 94.80 242 13 MET A 548 ? ? -67.73 78.41 243 13 GLN A 551 ? ? -86.19 -79.24 244 13 ILE A 555 ? ? -145.64 -40.25 245 13 CYS A 556 ? ? -109.88 57.71 246 13 LEU A 558 ? ? -143.12 -49.57 247 13 ARG A 559 ? ? 176.28 34.08 248 14 GLN A 508 ? ? -166.68 53.67 249 14 CYS A 511 ? ? 60.10 86.11 250 14 HIS A 516 ? ? -177.62 -56.00 251 14 THR A 520 ? ? -94.42 -70.11 252 14 ILE A 527 ? ? -136.09 -50.77 253 14 LEU A 529 ? ? 81.01 -28.89 254 14 PRO A 533 ? ? -90.12 31.97 255 14 TYR A 534 ? ? 172.20 -34.77 256 14 GLU A 540 ? ? 71.85 -58.91 257 14 ILE A 544 ? ? 34.34 -73.22 258 14 LEU A 547 ? ? -157.87 -17.86 259 14 ASN A 550 ? ? 172.89 -75.68 260 14 GLN A 551 ? ? 41.19 -85.82 261 14 ILE A 555 ? ? -141.91 -39.19 262 14 CYS A 556 ? ? -115.13 66.84 263 14 ARG A 559 ? ? -171.33 34.79 264 15 GLN A 508 ? ? -162.79 52.94 265 15 CYS A 511 ? ? 58.64 97.91 266 15 ASN A 514 ? ? -119.22 56.62 267 15 HIS A 516 ? ? -173.85 -56.37 268 15 GLN A 521 ? ? -100.45 -158.13 269 15 GLU A 523 ? ? 44.67 73.99 270 15 ALA A 525 ? ? 54.28 10.00 271 15 ALA A 526 ? ? 47.03 16.52 272 15 LEU A 529 ? ? 75.07 -22.18 273 15 ALA A 539 ? ? -49.29 -78.81 274 15 GLU A 540 ? ? 76.15 -44.62 275 15 ILE A 542 ? ? -149.95 -32.97 276 15 ILE A 544 ? ? 36.14 -72.26 277 15 LEU A 547 ? ? -144.72 -8.24 278 15 ASN A 550 ? ? 55.67 95.21 279 15 GLN A 551 ? ? -125.45 -76.12 280 15 ILE A 555 ? ? -140.59 -42.47 281 15 LEU A 558 ? ? -136.03 -48.17 282 15 ARG A 559 ? ? -178.65 37.92 283 16 GLN A 508 ? ? 77.99 61.59 284 16 CYS A 511 ? ? 63.62 98.36 285 16 ASN A 514 ? ? -119.61 52.58 286 16 HIS A 516 ? ? -177.04 -53.04 287 16 THR A 520 ? ? -97.80 -67.59 288 16 LEU A 529 ? ? 73.72 -51.53 289 16 ALA A 530 ? ? -79.48 45.10 290 16 TYR A 534 ? ? -161.57 6.68 291 16 GLU A 540 ? ? 72.61 -58.26 292 16 ILE A 542 ? ? -144.66 -5.84 293 16 ILE A 544 ? ? 36.70 -73.39 294 16 GLU A 545 ? ? 65.47 96.92 295 16 MET A 548 ? ? -66.44 76.30 296 16 ASN A 550 ? ? 70.38 -64.41 297 16 GLN A 551 ? ? 42.66 -84.27 298 16 ASP A 552 ? ? 59.63 16.53 299 16 ILE A 555 ? ? -145.19 -29.95 300 16 ARG A 559 ? ? -178.17 35.65 301 17 GLN A 508 ? ? -144.63 50.57 302 17 CYS A 511 ? ? 63.74 109.02 303 17 ASN A 514 ? ? -106.06 66.20 304 17 LEU A 515 ? ? -133.27 -30.46 305 17 HIS A 516 ? ? -173.00 -78.99 306 17 TYR A 517 ? ? -67.40 12.05 307 17 TRP A 518 ? ? -139.26 -39.57 308 17 GLN A 521 ? ? -100.70 -158.02 309 17 GLU A 523 ? ? 47.07 71.95 310 17 ALA A 525 ? ? 54.24 11.35 311 17 ALA A 526 ? ? 47.55 16.20 312 17 LEU A 529 ? ? 75.51 -20.06 313 17 GLU A 540 ? ? -151.32 -34.11 314 17 ILE A 542 ? ? -149.92 -33.86 315 17 ILE A 544 ? ? 42.40 -72.48 316 17 ASN A 550 ? ? 58.90 80.98 317 17 GLN A 551 ? ? -108.57 -77.44 318 17 ILE A 555 ? ? -146.35 -41.75 319 17 CYS A 556 ? ? -107.96 48.96 320 17 ARG A 559 ? ? 176.37 35.76 321 18 GLN A 508 ? ? -168.88 66.06 322 18 CYS A 511 ? ? 60.84 100.95 323 18 ASN A 514 ? ? -103.44 65.66 324 18 HIS A 516 ? ? 179.83 -82.95 325 18 TYR A 517 ? ? -62.48 7.94 326 18 TRP A 518 ? ? -135.57 -40.23 327 18 THR A 520 ? ? -97.76 -62.38 328 18 GLN A 521 ? ? -100.45 -163.64 329 18 GLU A 523 ? ? 41.61 79.56 330 18 ALA A 525 ? ? 28.66 28.76 331 18 ALA A 526 ? ? 42.56 16.22 332 18 LEU A 529 ? ? 69.32 -46.04 333 18 TYR A 534 ? ? -161.90 6.56 334 18 ILE A 542 ? ? -150.26 -35.06 335 18 ILE A 544 ? ? 33.95 -73.39 336 18 GLU A 545 ? ? 69.13 87.40 337 18 MET A 548 ? ? -58.36 102.85 338 18 HIS A 549 ? ? -179.75 -64.00 339 18 ASN A 550 ? ? 175.33 108.94 340 18 GLN A 551 ? ? -129.85 -72.60 341 18 ASP A 552 ? ? 45.50 28.46 342 18 ILE A 555 ? ? -141.74 -42.58 343 18 CYS A 556 ? ? -115.48 58.37 344 18 LEU A 558 ? ? -147.09 -45.74 345 18 ARG A 559 ? ? 177.91 37.60 346 19 GLN A 508 ? ? -168.25 63.81 347 19 PRO A 509 ? ? -62.89 97.32 348 19 CYS A 511 ? ? 64.84 88.95 349 19 HIS A 516 ? ? -175.76 -56.36 350 19 GLN A 521 ? ? -100.54 -161.92 351 19 GLU A 523 ? ? 43.56 77.28 352 19 ALA A 525 ? ? 54.00 10.68 353 19 ALA A 526 ? ? 47.13 15.99 354 19 LEU A 529 ? ? 74.68 -47.02 355 19 ALA A 530 ? ? -79.54 43.98 356 19 TYR A 534 ? ? -176.83 -27.28 357 19 GLU A 540 ? ? -157.71 -36.10 358 19 ILE A 542 ? ? -146.57 -33.30 359 19 ILE A 544 ? ? 37.00 -73.10 360 19 LEU A 547 ? ? -160.53 -14.91 361 19 MET A 548 ? ? -67.86 64.36 362 19 ASN A 550 ? ? 58.15 86.03 363 19 GLN A 551 ? ? -112.23 -77.84 364 19 ILE A 555 ? ? -142.94 -40.29 365 19 CYS A 556 ? ? -110.97 54.52 366 19 ARG A 559 ? ? -175.41 34.84 367 20 GLN A 508 ? ? 84.51 69.92 368 20 HIS A 516 ? ? -175.48 -56.43 369 20 THR A 520 ? ? -98.55 -70.87 370 20 ASP A 522 ? ? -96.19 30.83 371 20 ILE A 527 ? ? -132.73 -60.41 372 20 LEU A 529 ? ? 75.20 -20.31 373 20 ALA A 539 ? ? -49.36 159.37 374 20 GLU A 540 ? ? -149.28 -44.33 375 20 ILE A 542 ? ? -145.06 -4.85 376 20 ILE A 544 ? ? 38.89 -73.09 377 20 LEU A 547 ? ? -149.88 -16.22 378 20 MET A 548 ? ? -69.46 65.73 379 20 ASN A 550 ? ? 58.14 93.67 380 20 GLN A 551 ? ? -120.72 -76.44 381 20 ILE A 555 ? ? -148.10 -44.44 382 20 ARG A 559 ? ? -177.86 30.32 #