data_2LDN # _entry.id 2LDN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LDN RCSB RCSB102267 BMRB 17674 WWPDB D_1000102267 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2012-07-18 _pdbx_database_PDB_obs_spr.pdb_id NONE _pdbx_database_PDB_obs_spr.replace_pdb_id 2LDN _pdbx_database_PDB_obs_spr.details 'THIS ENTRY IS OBSOLETED DUE TO WITHDRAWN OF PRIMARY PAPER.' # _pdbx_database_related.db_id 17674 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LDN _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2011-05-30 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_mr OBS _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs OBS _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mohan, S.K.' 1 'Rani, S.G.' 2 'Yu, C.' 3 # _citation.id primary _citation.title 'WITHDRAWN: Interaction of FGF1 with a novel anti-angiogenic drug SSR128129E' _citation.journal_abbrev Arch.Biochem.Biophys. _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year 2012 _citation.journal_id_ASTM ABBIA4 _citation.country US _citation.journal_id_ISSN 1096-0384 _citation.journal_id_CSD 0158 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22683470 _citation.pdbx_database_id_DOI 10.1016/j.abb.2012.05.020 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Mohan, S.K.' 1 primary 'Rani, S.G.' 2 primary 'Chiu, I.M.' 3 primary 'Yu, C.' 4 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Heparin-binding growth factor 1' 14828.799 1 ? ? 'residues in UNP 23-152' ? 2 non-polymer syn '2-amino-5-[(1-methoxy-2-methylindolizin-3-yl)carbonyl]benzoic acid' 324.331 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HBGF-1, Acidic fibroblast growth factor, aFGF, Beta-endothelial cell growth factor, ECGF-beta' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;YKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLE RLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV ; _entity_poly.pdbx_seq_one_letter_code_can ;YKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLE RLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 LYS n 1 3 LYS n 1 4 PRO n 1 5 LYS n 1 6 LEU n 1 7 LEU n 1 8 TYR n 1 9 CYS n 1 10 SER n 1 11 ASN n 1 12 GLY n 1 13 GLY n 1 14 HIS n 1 15 PHE n 1 16 LEU n 1 17 ARG n 1 18 ILE n 1 19 LEU n 1 20 PRO n 1 21 ASP n 1 22 GLY n 1 23 THR n 1 24 VAL n 1 25 ASP n 1 26 GLY n 1 27 THR n 1 28 ARG n 1 29 ASP n 1 30 ARG n 1 31 SER n 1 32 ASP n 1 33 GLN n 1 34 HIS n 1 35 ILE n 1 36 GLN n 1 37 LEU n 1 38 GLN n 1 39 LEU n 1 40 SER n 1 41 ALA n 1 42 GLU n 1 43 SER n 1 44 VAL n 1 45 GLY n 1 46 GLU n 1 47 VAL n 1 48 TYR n 1 49 ILE n 1 50 LYS n 1 51 SER n 1 52 THR n 1 53 GLU n 1 54 THR n 1 55 GLY n 1 56 GLN n 1 57 TYR n 1 58 LEU n 1 59 ALA n 1 60 MET n 1 61 ASP n 1 62 THR n 1 63 ASP n 1 64 GLY n 1 65 LEU n 1 66 LEU n 1 67 TYR n 1 68 GLY n 1 69 SER n 1 70 GLN n 1 71 THR n 1 72 PRO n 1 73 ASN n 1 74 GLU n 1 75 GLU n 1 76 CYS n 1 77 LEU n 1 78 PHE n 1 79 LEU n 1 80 GLU n 1 81 ARG n 1 82 LEU n 1 83 GLU n 1 84 GLU n 1 85 ASN n 1 86 HIS n 1 87 TYR n 1 88 ASN n 1 89 THR n 1 90 TYR n 1 91 ILE n 1 92 SER n 1 93 LYS n 1 94 LYS n 1 95 HIS n 1 96 ALA n 1 97 GLU n 1 98 LYS n 1 99 ASN n 1 100 TRP n 1 101 PHE n 1 102 VAL n 1 103 GLY n 1 104 LEU n 1 105 LYS n 1 106 LYS n 1 107 ASN n 1 108 GLY n 1 109 SER n 1 110 CYS n 1 111 LYS n 1 112 ARG n 1 113 GLY n 1 114 PRO n 1 115 ARG n 1 116 THR n 1 117 HIS n 1 118 TYR n 1 119 GLY n 1 120 GLN n 1 121 LYS n 1 122 ALA n 1 123 ILE n 1 124 LEU n 1 125 PHE n 1 126 LEU n 1 127 PRO n 1 128 LEU n 1 129 PRO n 1 130 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FGF _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET20b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FGF1_HUMAN _struct_ref.pdbx_db_accession P05230 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;YKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLE RLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV ; _struct_ref.pdbx_align_begin 23 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LDN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P05230 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 152 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 130 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SSF non-polymer . '2-amino-5-[(1-methoxy-2-methylindolizin-3-yl)carbonyl]benzoic acid' ? 'C18 H16 N2 O4' 324.331 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCA' 1 3 1 '3D HNCO' 1 4 1 '3D HNCACB' 1 5 1 '3D HBHA(CO)NH' 1 6 1 '3D HN(CO)CA' 1 7 1 '3D C(CO)NH' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '3D 1H-13C NOESY' 1 12 1 '3D 13C-Filter NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 # _pdbx_nmr_sample_details.contents '1.0mM [U-100% 13C; U-100% 15N] FGF1-1, 2.1mM SSR-2, 25mM sodium phosphate-3, 100mM ammonium sulfate-4, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LDN _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LDN _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LDN _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 1 1.2 Varian collection VNMRJ 2 ? Varian processing VNMRJ 3 ? Goddard 'chemical shift assignment' SPARKY 4 ? Goddard 'peak picking' SPARKY 5 ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 6 ? ? refinement CNS 7 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LDN _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LDN _struct.title 'Solution structure of FGF1-SSR128129E' _struct.pdbx_descriptor 'Heparin-binding growth factor 1' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LDN _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' _struct_keywords.text 'Fibroblast growth factor, Beta sheet protein, Protein-drug complex, PROTEIN TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 73 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 76 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 73 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 76 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 4 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 6 ? CYS A 9 ? LEU A 6 CYS A 9 A 2 PHE A 125 ? LEU A 128 ? PHE A 125 LEU A 128 B 1 PHE A 15 ? ILE A 18 ? PHE A 15 ILE A 18 B 2 VAL A 24 ? THR A 27 ? VAL A 24 THR A 27 C 1 LEU A 37 ? ALA A 41 ? LEU A 37 ALA A 41 C 2 GLU A 46 ? SER A 51 ? GLU A 46 SER A 51 C 3 PHE A 78 ? GLU A 83 ? PHE A 78 GLU A 83 C 4 TYR A 87 ? SER A 92 ? TYR A 87 SER A 92 D 1 TYR A 57 ? MET A 60 ? TYR A 57 MET A 60 D 2 LEU A 66 ? SER A 69 ? LEU A 66 SER A 69 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 6 ? N LEU A 6 O LEU A 128 ? O LEU A 128 B 1 2 N PHE A 15 ? N PHE A 15 O THR A 27 ? O THR A 27 C 1 2 N GLN A 38 ? N GLN A 38 O LYS A 50 ? O LYS A 50 C 2 3 N VAL A 47 ? N VAL A 47 O PHE A 78 ? O PHE A 78 C 3 4 N ARG A 81 ? N ARG A 81 O THR A 89 ? O THR A 89 D 1 2 N TYR A 57 ? N TYR A 57 O SER A 69 ? O SER A 69 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SSF A 131' AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SSF A 132' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLN A 33 ? GLN A 33 . ? 1_555 ? 2 AC1 4 THR A 52 ? THR A 52 . ? 1_555 ? 3 AC1 4 GLU A 53 ? GLU A 53 . ? 1_555 ? 4 AC1 4 VAL A 130 ? VAL A 130 . ? 1_555 ? 5 AC2 3 GLU A 83 ? GLU A 83 . ? 1_555 ? 6 AC2 3 GLU A 84 ? GLU A 84 . ? 1_555 ? 7 AC2 3 GLY A 119 ? GLY A 119 . ? 1_555 ? # _atom_sites.entry_id 2LDN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 1 1 TYR TYR A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 TRP 100 100 100 TRP TRP A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 CYS 110 110 110 CYS CYS A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 VAL 130 130 130 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SSF 1 131 1 SSF SSF A . C 2 SSF 1 132 1 SSF SSF A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-06-06 2 'Structure model' 1 1 2012-07-18 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group Other # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id FGF1-1 1.0 ? mM '[U-100% 13C; U-100% 15N]' 1 SSR-2 2.1 ? mM ? 1 'sodium phosphate-3' 25 ? mM ? 1 'ammonium sulfate-4' 100 ? mM ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 31 ? ? -96.72 51.43 2 1 HIS A 86 ? ? -160.15 -51.98 3 1 HIS A 95 ? ? -112.97 54.78 4 1 ASN A 99 ? ? 64.42 64.00 5 2 LYS A 2 ? ? -144.63 -66.34 6 2 HIS A 86 ? ? -158.33 -55.31 7 2 HIS A 95 ? ? -118.02 71.41 8 2 ASN A 99 ? ? 63.87 68.42 9 3 HIS A 86 ? ? -158.53 -53.38 10 3 HIS A 95 ? ? -117.83 59.26 11 3 ASN A 99 ? ? 62.24 60.74 12 4 LYS A 2 ? ? -127.25 -59.47 13 4 HIS A 86 ? ? -161.40 -56.70 14 4 ASN A 99 ? ? 61.96 70.25 15 5 HIS A 86 ? ? -158.08 -54.63 16 5 ASN A 99 ? ? 58.46 72.01 17 6 LYS A 2 ? ? -139.26 -60.66 18 6 SER A 31 ? ? -95.33 46.84 19 6 HIS A 86 ? ? -164.44 -50.29 20 6 HIS A 95 ? ? -107.09 62.00 21 6 ASN A 99 ? ? 62.61 63.17 22 7 HIS A 86 ? ? -160.56 -53.99 23 7 HIS A 95 ? ? -109.78 64.47 24 7 ASN A 99 ? ? 61.91 75.88 25 8 LYS A 2 ? ? -139.04 -54.36 26 8 HIS A 86 ? ? -162.15 -54.58 27 8 ASN A 99 ? ? 62.33 77.52 28 9 HIS A 86 ? ? -164.42 -51.60 29 9 HIS A 95 ? ? -104.61 62.88 30 9 ASN A 99 ? ? 62.77 65.28 31 10 HIS A 86 ? ? -161.60 -50.49 32 10 HIS A 95 ? ? -110.00 56.93 33 10 ASN A 99 ? ? 62.82 63.81 34 11 HIS A 86 ? ? -163.82 -52.45 35 11 HIS A 95 ? ? -112.55 60.35 36 12 LYS A 2 ? ? -120.38 -51.52 37 12 HIS A 86 ? ? -160.12 -54.03 38 12 HIS A 95 ? ? -112.26 66.65 39 12 ASN A 99 ? ? 61.20 68.01 40 13 HIS A 86 ? ? -160.90 -50.10 41 13 HIS A 95 ? ? -107.16 54.39 42 13 ASN A 99 ? ? 68.54 79.27 43 14 HIS A 86 ? ? -162.46 -51.41 44 14 HIS A 95 ? ? -105.90 60.19 45 14 ASN A 99 ? ? 60.65 68.99 46 15 HIS A 86 ? ? -160.39 -52.75 47 15 HIS A 95 ? ? -118.95 57.54 48 15 ASN A 99 ? ? 64.15 67.56 49 16 HIS A 86 ? ? -162.98 -51.46 50 16 HIS A 95 ? ? -109.38 62.53 51 16 ASN A 99 ? ? 62.31 66.22 52 17 LYS A 2 ? ? -140.29 -58.90 53 17 HIS A 86 ? ? -158.37 -57.83 54 17 HIS A 95 ? ? -106.85 55.82 55 17 ASN A 99 ? ? 57.41 73.28 56 18 HIS A 86 ? ? -160.65 -54.97 57 18 HIS A 95 ? ? -112.61 61.74 58 18 ASN A 99 ? ? 65.64 65.71 59 19 LYS A 2 ? ? -128.20 -55.01 60 19 HIS A 86 ? ? -157.24 -55.01 61 19 HIS A 95 ? ? -104.20 63.05 62 19 ASN A 99 ? ? 62.66 63.21 63 20 LYS A 2 ? ? -136.79 -58.98 64 20 HIS A 86 ? ? -162.91 -52.67 65 20 ASN A 99 ? ? 62.86 72.60 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '2-amino-5-[(1-methoxy-2-methylindolizin-3-yl)carbonyl]benzoic acid' _pdbx_entity_nonpoly.comp_id SSF #