data_2LDS
# 
_entry.id   2LDS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2LDS         pdb_00002lds 10.2210/pdb2lds/pdb 
RCSB  RCSB102272   ?            ?                   
BMRB  17681        ?            10.13018/BMR17681   
WWPDB D_1000102272 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-09-14 
2 'Structure model' 1 1 2011-10-12 
3 'Structure model' 1 2 2023-06-14 
4 'Structure model' 1 3 2024-10-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Structure summary'   
2 3 'Structure model' 'Database references' 
3 3 'Structure model' Other                 
4 4 'Structure model' 'Data collection'     
5 4 'Structure model' 'Database references' 
6 4 'Structure model' 'Structure summary'   
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_2                
2 3 'Structure model' pdbx_database_status      
3 4 'Structure model' chem_comp_atom            
4 4 'Structure model' chem_comp_bond            
5 4 'Structure model' database_2                
6 4 'Structure model' pdbx_entry_details        
7 4 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_database_2.pdbx_DOI'                       
2 3 'Structure model' '_database_2.pdbx_database_accession'        
3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 
4 4 'Structure model' '_database_2.pdbx_DOI'                       
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LDS 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2011-06-01 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            REL 
_pdbx_database_status.methods_development_category    ? 
# 
_pdbx_database_related.db_id          17681 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Horita, S.'   1 
'Miyakawa, T.' 2 
'Nagata, K.'   3 
'Tanokura, M.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of a short-chain insecticidal toxin LaIT1 from the venom of scorpion Liocheles australasiae.' 
_citation.journal_abbrev            Biochem.Biophys.Res.Commun. 
_citation.journal_volume            411 
_citation.page_first                738 
_citation.page_last                 744 
_citation.year                      2011 
_citation.journal_id_ASTM           BBRCA9 
_citation.country                   US 
_citation.journal_id_ISSN           0006-291X 
_citation.journal_id_CSD            0146 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21782787 
_citation.pdbx_database_id_DOI      10.1016/j.bbrc.2011.07.016 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Horita, S.'     1  ? 
primary 'Matsushita, N.' 2  ? 
primary 'Kawachi, T.'    3  ? 
primary 'Ayabe, R.'      4  ? 
primary 'Miyashita, M.'  5  ? 
primary 'Miyakawa, T.'   6  ? 
primary 'Nakagawa, Y.'   7  ? 
primary 'Nagata, K.'     8  ? 
primary 'Miyagawa, H.'   9  ? 
primary 'Tanokura, M.'   10 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Insecticidal toxin LaIT1' 
_entity.formula_weight             4214.993 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       DFPLSKEYETCVRPRKCQPPLKCNKAQICVDPKKGW 
_entity_poly.pdbx_seq_one_letter_code_can   DFPLSKEYETCVRPRKCQPPLKCNKAQICVDPKKGW 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ASP n 
1 2  PHE n 
1 3  PRO n 
1 4  LEU n 
1 5  SER n 
1 6  LYS n 
1 7  GLU n 
1 8  TYR n 
1 9  GLU n 
1 10 THR n 
1 11 CYS n 
1 12 VAL n 
1 13 ARG n 
1 14 PRO n 
1 15 ARG n 
1 16 LYS n 
1 17 CYS n 
1 18 GLN n 
1 19 PRO n 
1 20 PRO n 
1 21 LEU n 
1 22 LYS n 
1 23 CYS n 
1 24 ASN n 
1 25 LYS n 
1 26 ALA n 
1 27 GLN n 
1 28 ILE n 
1 29 CYS n 
1 30 VAL n 
1 31 ASP n 
1 32 PRO n 
1 33 LYS n 
1 34 LYS n 
1 35 GLY n 
1 36 TRP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Wood scorpion' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Liocheles australasiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     431266 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pET32a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ASP 1  1  1  ASP ASP A . n 
A 1 2  PHE 2  2  2  PHE PHE A . n 
A 1 3  PRO 3  3  3  PRO PRO A . n 
A 1 4  LEU 4  4  4  LEU LEU A . n 
A 1 5  SER 5  5  5  SER SER A . n 
A 1 6  LYS 6  6  6  LYS LYS A . n 
A 1 7  GLU 7  7  7  GLU GLU A . n 
A 1 8  TYR 8  8  8  TYR TYR A . n 
A 1 9  GLU 9  9  9  GLU GLU A . n 
A 1 10 THR 10 10 10 THR THR A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 VAL 12 12 12 VAL VAL A . n 
A 1 13 ARG 13 13 13 ARG ARG A . n 
A 1 14 PRO 14 14 14 PRO PRO A . n 
A 1 15 ARG 15 15 15 ARG ARG A . n 
A 1 16 LYS 16 16 16 LYS LYS A . n 
A 1 17 CYS 17 17 17 CYS CYS A . n 
A 1 18 GLN 18 18 18 GLN GLN A . n 
A 1 19 PRO 19 19 19 PRO PRO A . n 
A 1 20 PRO 20 20 20 PRO PRO A . n 
A 1 21 LEU 21 21 21 LEU LEU A . n 
A 1 22 LYS 22 22 22 LYS LYS A . n 
A 1 23 CYS 23 23 23 CYS CYS A . n 
A 1 24 ASN 24 24 24 ASN ASN A . n 
A 1 25 LYS 25 25 25 LYS LYS A . n 
A 1 26 ALA 26 26 26 ALA ALA A . n 
A 1 27 GLN 27 27 27 GLN GLN A . n 
A 1 28 ILE 28 28 28 ILE ILE A . n 
A 1 29 CYS 29 29 29 CYS CYS A . n 
A 1 30 VAL 30 30 30 VAL VAL A . n 
A 1 31 ASP 31 31 31 ASP ASP A . n 
A 1 32 PRO 32 32 32 PRO PRO A . n 
A 1 33 LYS 33 33 33 LYS LYS A . n 
A 1 34 LYS 34 34 34 LYS LYS A . n 
A 1 35 GLY 35 35 35 GLY GLY A . n 
A 1 36 TRP 36 36 36 TRP TRP A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2LDS 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LDS 
_struct.title                     'Solution Structure of a Short-chain LaIT1 from the Venom of Scorpion Liocheles australasiae' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LDS 
_struct_keywords.pdbx_keywords   TOXIN 
_struct_keywords.text            'Inhibitor Cystine Knot (ICK) fold, scorpion toxin, toxin' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LAIT1_LIOAU 
_struct_ref.pdbx_db_accession          P0C5F2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   DFPLSKEYETCVRPRKCQPPLKCNKAQICVDPKKGW 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2LDS 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 36 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P0C5F2 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  36 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       36 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 23 SG ? ? A CYS 11 A CYS 23 1_555 ? ? ? ? ? ? ? 2.051 ? ? 
disulf2 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 17 A CYS 29 1_555 ? ? ? ? ? ? ? 1.917 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 CYS A 11 ? CYS A 23 ? CYS A 11 ? 1_555 CYS A 23 ? 1_555 SG SG . . . None 'Disulfide bridge' 
2 CYS A 17 ? CYS A 29 ? CYS A 17 ? 1_555 CYS A 29 ? 1_555 SG SG . . . None 'Disulfide bridge' 
# 
_pdbx_entry_details.entry_id                   2LDS 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  LEU A 4  ? ? 62.09   163.05  
2   1  GLU A 7  ? ? 63.37   -169.86 
3   1  GLU A 9  ? ? 179.65  -66.00  
4   1  THR A 10 ? ? 178.94  158.42  
5   1  CYS A 11 ? ? -164.00 56.13   
6   1  VAL A 12 ? ? -66.46  -176.84 
7   1  ARG A 15 ? ? -115.60 69.57   
8   1  PRO A 20 ? ? -69.85  75.30   
9   1  ASN A 24 ? ? -131.65 -61.14  
10  1  LYS A 25 ? ? -179.59 -34.46  
11  1  GLN A 27 ? ? 58.99   98.90   
12  1  ILE A 28 ? ? -146.32 -49.69  
13  1  CYS A 29 ? ? 66.73   125.58  
14  2  GLU A 7  ? ? 52.72   -172.75 
15  2  GLU A 9  ? ? -177.03 -75.61  
16  2  THR A 10 ? ? -178.96 122.91  
17  2  VAL A 12 ? ? 64.53   152.64  
18  2  PRO A 20 ? ? -69.76  94.98   
19  2  ASN A 24 ? ? -131.77 -54.02  
20  2  LYS A 25 ? ? -179.57 -39.41  
21  2  GLN A 27 ? ? 57.97   96.18   
22  2  ILE A 28 ? ? -136.05 -40.14  
23  2  CYS A 29 ? ? 66.35   117.55  
24  3  LEU A 4  ? ? 48.64   -168.82 
25  3  GLU A 7  ? ? 63.57   -169.93 
26  3  GLU A 9  ? ? -175.65 30.90   
27  3  THR A 10 ? ? 50.49   89.47   
28  3  PRO A 20 ? ? -69.81  86.13   
29  3  ASN A 24 ? ? -128.70 -74.71  
30  3  LYS A 25 ? ? -163.64 -38.67  
31  3  GLN A 27 ? ? 63.31   95.63   
32  3  ILE A 28 ? ? -139.12 -46.05  
33  3  CYS A 29 ? ? 67.10   127.76  
34  3  ASP A 31 ? ? 177.76  159.94  
35  4  PHE A 2  ? ? 51.99   74.56   
36  4  PRO A 3  ? ? -69.71  78.54   
37  4  TYR A 8  ? ? 63.29   74.14   
38  4  GLU A 9  ? ? -170.63 -72.88  
39  4  THR A 10 ? ? -173.68 -179.82 
40  4  CYS A 11 ? ? -179.53 71.12   
41  4  PRO A 20 ? ? -69.73  75.22   
42  4  ASN A 24 ? ? -132.98 -74.60  
43  4  LYS A 25 ? ? -162.62 -40.26  
44  4  GLN A 27 ? ? 61.18   92.20   
45  4  ILE A 28 ? ? -136.47 -44.21  
46  4  CYS A 29 ? ? 66.34   127.00  
47  5  PHE A 2  ? ? 64.39   153.72  
48  5  LEU A 4  ? ? -174.90 139.80  
49  5  SER A 5  ? ? -59.67  -171.60 
50  5  LYS A 6  ? ? -113.04 -168.86 
51  5  GLU A 7  ? ? 64.23   -178.23 
52  5  GLU A 9  ? ? -165.39 -76.77  
53  5  THR A 10 ? ? 176.45  135.09  
54  5  PRO A 20 ? ? -69.71  90.09   
55  5  ASN A 24 ? ? -133.78 -73.42  
56  5  LYS A 25 ? ? -179.55 34.37   
57  5  ALA A 26 ? ? -165.49 27.64   
58  5  ASP A 31 ? ? 178.39  159.42  
59  5  PRO A 32 ? ? -69.86  55.72   
60  5  LYS A 33 ? ? -147.17 -47.79  
61  5  LYS A 34 ? ? -165.15 108.68  
62  6  GLU A 7  ? ? 58.46   -169.65 
63  6  GLU A 9  ? ? -173.48 -61.50  
64  6  THR A 10 ? ? -179.29 114.57  
65  6  PRO A 14 ? ? -69.77  73.07   
66  6  ARG A 15 ? ? 179.10  -65.82  
67  6  LYS A 16 ? ? 60.91   102.19  
68  6  PRO A 20 ? ? -69.92  76.61   
69  6  ASN A 24 ? ? -130.34 -57.50  
70  6  LYS A 25 ? ? 178.41  35.06   
71  6  ALA A 26 ? ? -164.85 -77.16  
72  6  GLN A 27 ? ? -179.53 34.63   
73  6  LYS A 34 ? ? -175.60 87.46   
74  7  LEU A 4  ? ? -93.46  -77.74  
75  7  SER A 5  ? ? 49.73   -167.95 
76  7  GLU A 7  ? ? 51.39   -166.65 
77  7  GLU A 9  ? ? -167.11 -76.50  
78  7  THR A 10 ? ? -179.32 120.22  
79  7  ARG A 15 ? ? -51.85  -77.12  
80  7  LYS A 16 ? ? 64.23   115.57  
81  7  PRO A 20 ? ? -69.86  80.31   
82  7  ASN A 24 ? ? -141.24 -75.17  
83  7  LYS A 25 ? ? -164.78 -38.29  
84  7  GLN A 27 ? ? 66.42   60.20   
85  7  ASP A 31 ? ? 178.28  159.98  
86  8  PHE A 2  ? ? 52.93   73.33   
87  8  PRO A 3  ? ? -69.72  97.93   
88  8  LEU A 4  ? ? -56.67  178.80  
89  8  LYS A 6  ? ? -63.75  -173.90 
90  8  TYR A 8  ? ? 63.68   -166.43 
91  8  GLU A 9  ? ? 70.40   -76.17  
92  8  CYS A 11 ? ? -170.98 42.11   
93  8  VAL A 12 ? ? -62.49  -176.38 
94  8  PRO A 20 ? ? -69.75  79.14   
95  8  ASN A 24 ? ? -130.98 -74.20  
96  8  LYS A 25 ? ? -160.20 -41.89  
97  8  GLN A 27 ? ? 61.07   97.23   
98  8  ILE A 28 ? ? -142.21 -41.33  
99  8  CYS A 29 ? ? 67.27   128.78  
100 8  ASP A 31 ? ? -178.61 76.36   
101 8  LYS A 34 ? ? -170.29 35.26   
102 9  PHE A 2  ? ? -119.75 74.49   
103 9  SER A 5  ? ? -78.92  -169.40 
104 9  LYS A 6  ? ? -164.97 -165.54 
105 9  GLU A 7  ? ? 68.32   -157.38 
106 9  VAL A 12 ? ? -58.27  -176.88 
107 9  PRO A 20 ? ? -69.73  77.76   
108 9  ASN A 24 ? ? -130.86 -57.89  
109 9  LYS A 25 ? ? 179.36  -40.10  
110 9  GLN A 27 ? ? 63.71   88.49   
111 9  ILE A 28 ? ? -135.14 -42.98  
112 9  CYS A 29 ? ? 67.33   129.36  
113 9  ASP A 31 ? ? 177.89  159.94  
114 10 LEU A 4  ? ? 59.36   103.33  
115 10 GLU A 7  ? ? 53.76   -169.63 
116 10 GLU A 9  ? ? -175.71 -74.70  
117 10 THR A 10 ? ? -177.31 135.20  
118 10 PRO A 20 ? ? -69.85  81.79   
119 10 ASN A 24 ? ? -131.08 -62.54  
120 10 LYS A 25 ? ? 179.99  -33.69  
121 10 GLN A 27 ? ? 58.69   98.39   
122 10 ILE A 28 ? ? -146.41 -52.50  
123 10 CYS A 29 ? ? 67.01   126.95  
124 10 PRO A 32 ? ? -69.78  55.69   
125 10 LYS A 33 ? ? -150.43 -43.08  
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LDS 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LDS 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.contents         '90% H2O-1, 10% D2O-2, 20mM MES-3, 50mM sodium chloride-4, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
H2O-1               90 ? %  ? 1 
D2O-2               10 ? %  ? 1 
MES-3               20 ? mM ? 1 
'sodium chloride-4' 50 ? mM ? 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '3D HNCO'         
1 3  1 '3D HN(CO)CA'     
1 4  1 '3D CBCA(CO)NH'   
1 5  1 '3D HNCACB'       
1 6  1 '3D HBHA(CO)NH'   
1 7  1 '3D HCCH-TOCSY'   
1 8  1 '3D HCCH-COSY'    
1 9  1 '3D 1H-15N NOESY' 
1 10 1 '3D 1H-13C NOESY' 
1 11 1 '2D 1H-13C HSQC'  
# 
_pdbx_nmr_constraints.disulfide_bond_constraints_total_count        ? 
_pdbx_nmr_constraints.entry_id                                      2LDS 
_pdbx_nmr_constraints.hydrogen_bond_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_beta-angle_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_chi-angle_constraints_total_count          ? 
_pdbx_nmr_constraints.NA_delta-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count      ? 
_pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_other-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count       ? 
_pdbx_nmr_constraints.NOE_constraints_total                         303 
_pdbx_nmr_constraints.NOE_interentity_total_count                   ? 
_pdbx_nmr_constraints.NOE_interproton_distance_evaluation           ? 
_pdbx_nmr_constraints.NOE_intraresidue_total_count                  57 
_pdbx_nmr_constraints.NOE_long_range_total_count                    76 
_pdbx_nmr_constraints.NOE_medium_range_total_count                  54 
_pdbx_nmr_constraints.NOE_motional_averaging_correction             ? 
_pdbx_nmr_constraints.NOE_pseudoatom_corrections                    ? 
_pdbx_nmr_constraints.NOE_sequential_total_count                    112 
_pdbx_nmr_constraints.protein_chi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_other_angle_constraints_total_count   ? 
_pdbx_nmr_constraints.protein_phi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_psi_angle_constraints_total_count     ? 
# 
_pdbx_nmr_refine.entry_id           2LDS 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.version 
'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 1 v2.1 
'Guntert, Mumenthaler and Wuthrich' refinement           CYANA 2 ?    
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
ILE N    N N N 137 
ILE CA   C N S 138 
ILE C    C N N 139 
ILE O    O N N 140 
ILE CB   C N S 141 
ILE CG1  C N N 142 
ILE CG2  C N N 143 
ILE CD1  C N N 144 
ILE OXT  O N N 145 
ILE H    H N N 146 
ILE H2   H N N 147 
ILE HA   H N N 148 
ILE HB   H N N 149 
ILE HG12 H N N 150 
ILE HG13 H N N 151 
ILE HG21 H N N 152 
ILE HG22 H N N 153 
ILE HG23 H N N 154 
ILE HD11 H N N 155 
ILE HD12 H N N 156 
ILE HD13 H N N 157 
ILE HXT  H N N 158 
LEU N    N N N 159 
LEU CA   C N S 160 
LEU C    C N N 161 
LEU O    O N N 162 
LEU CB   C N N 163 
LEU CG   C N N 164 
LEU CD1  C N N 165 
LEU CD2  C N N 166 
LEU OXT  O N N 167 
LEU H    H N N 168 
LEU H2   H N N 169 
LEU HA   H N N 170 
LEU HB2  H N N 171 
LEU HB3  H N N 172 
LEU HG   H N N 173 
LEU HD11 H N N 174 
LEU HD12 H N N 175 
LEU HD13 H N N 176 
LEU HD21 H N N 177 
LEU HD22 H N N 178 
LEU HD23 H N N 179 
LEU HXT  H N N 180 
LYS N    N N N 181 
LYS CA   C N S 182 
LYS C    C N N 183 
LYS O    O N N 184 
LYS CB   C N N 185 
LYS CG   C N N 186 
LYS CD   C N N 187 
LYS CE   C N N 188 
LYS NZ   N N N 189 
LYS OXT  O N N 190 
LYS H    H N N 191 
LYS H2   H N N 192 
LYS HA   H N N 193 
LYS HB2  H N N 194 
LYS HB3  H N N 195 
LYS HG2  H N N 196 
LYS HG3  H N N 197 
LYS HD2  H N N 198 
LYS HD3  H N N 199 
LYS HE2  H N N 200 
LYS HE3  H N N 201 
LYS HZ1  H N N 202 
LYS HZ2  H N N 203 
LYS HZ3  H N N 204 
LYS HXT  H N N 205 
PHE N    N N N 206 
PHE CA   C N S 207 
PHE C    C N N 208 
PHE O    O N N 209 
PHE CB   C N N 210 
PHE CG   C Y N 211 
PHE CD1  C Y N 212 
PHE CD2  C Y N 213 
PHE CE1  C Y N 214 
PHE CE2  C Y N 215 
PHE CZ   C Y N 216 
PHE OXT  O N N 217 
PHE H    H N N 218 
PHE H2   H N N 219 
PHE HA   H N N 220 
PHE HB2  H N N 221 
PHE HB3  H N N 222 
PHE HD1  H N N 223 
PHE HD2  H N N 224 
PHE HE1  H N N 225 
PHE HE2  H N N 226 
PHE HZ   H N N 227 
PHE HXT  H N N 228 
PRO N    N N N 229 
PRO CA   C N S 230 
PRO C    C N N 231 
PRO O    O N N 232 
PRO CB   C N N 233 
PRO CG   C N N 234 
PRO CD   C N N 235 
PRO OXT  O N N 236 
PRO H    H N N 237 
PRO HA   H N N 238 
PRO HB2  H N N 239 
PRO HB3  H N N 240 
PRO HG2  H N N 241 
PRO HG3  H N N 242 
PRO HD2  H N N 243 
PRO HD3  H N N 244 
PRO HXT  H N N 245 
SER N    N N N 246 
SER CA   C N S 247 
SER C    C N N 248 
SER O    O N N 249 
SER CB   C N N 250 
SER OG   O N N 251 
SER OXT  O N N 252 
SER H    H N N 253 
SER H2   H N N 254 
SER HA   H N N 255 
SER HB2  H N N 256 
SER HB3  H N N 257 
SER HG   H N N 258 
SER HXT  H N N 259 
THR N    N N N 260 
THR CA   C N S 261 
THR C    C N N 262 
THR O    O N N 263 
THR CB   C N R 264 
THR OG1  O N N 265 
THR CG2  C N N 266 
THR OXT  O N N 267 
THR H    H N N 268 
THR H2   H N N 269 
THR HA   H N N 270 
THR HB   H N N 271 
THR HG1  H N N 272 
THR HG21 H N N 273 
THR HG22 H N N 274 
THR HG23 H N N 275 
THR HXT  H N N 276 
TRP N    N N N 277 
TRP CA   C N S 278 
TRP C    C N N 279 
TRP O    O N N 280 
TRP CB   C N N 281 
TRP CG   C Y N 282 
TRP CD1  C Y N 283 
TRP CD2  C Y N 284 
TRP NE1  N Y N 285 
TRP CE2  C Y N 286 
TRP CE3  C Y N 287 
TRP CZ2  C Y N 288 
TRP CZ3  C Y N 289 
TRP CH2  C Y N 290 
TRP OXT  O N N 291 
TRP H    H N N 292 
TRP H2   H N N 293 
TRP HA   H N N 294 
TRP HB2  H N N 295 
TRP HB3  H N N 296 
TRP HD1  H N N 297 
TRP HE1  H N N 298 
TRP HE3  H N N 299 
TRP HZ2  H N N 300 
TRP HZ3  H N N 301 
TRP HH2  H N N 302 
TRP HXT  H N N 303 
TYR N    N N N 304 
TYR CA   C N S 305 
TYR C    C N N 306 
TYR O    O N N 307 
TYR CB   C N N 308 
TYR CG   C Y N 309 
TYR CD1  C Y N 310 
TYR CD2  C Y N 311 
TYR CE1  C Y N 312 
TYR CE2  C Y N 313 
TYR CZ   C Y N 314 
TYR OH   O N N 315 
TYR OXT  O N N 316 
TYR H    H N N 317 
TYR H2   H N N 318 
TYR HA   H N N 319 
TYR HB2  H N N 320 
TYR HB3  H N N 321 
TYR HD1  H N N 322 
TYR HD2  H N N 323 
TYR HE1  H N N 324 
TYR HE2  H N N 325 
TYR HH   H N N 326 
TYR HXT  H N N 327 
VAL N    N N N 328 
VAL CA   C N S 329 
VAL C    C N N 330 
VAL O    O N N 331 
VAL CB   C N N 332 
VAL CG1  C N N 333 
VAL CG2  C N N 334 
VAL OXT  O N N 335 
VAL H    H N N 336 
VAL H2   H N N 337 
VAL HA   H N N 338 
VAL HB   H N N 339 
VAL HG11 H N N 340 
VAL HG12 H N N 341 
VAL HG13 H N N 342 
VAL HG21 H N N 343 
VAL HG22 H N N 344 
VAL HG23 H N N 345 
VAL HXT  H N N 346 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
ILE N   CA   sing N N 129 
ILE N   H    sing N N 130 
ILE N   H2   sing N N 131 
ILE CA  C    sing N N 132 
ILE CA  CB   sing N N 133 
ILE CA  HA   sing N N 134 
ILE C   O    doub N N 135 
ILE C   OXT  sing N N 136 
ILE CB  CG1  sing N N 137 
ILE CB  CG2  sing N N 138 
ILE CB  HB   sing N N 139 
ILE CG1 CD1  sing N N 140 
ILE CG1 HG12 sing N N 141 
ILE CG1 HG13 sing N N 142 
ILE CG2 HG21 sing N N 143 
ILE CG2 HG22 sing N N 144 
ILE CG2 HG23 sing N N 145 
ILE CD1 HD11 sing N N 146 
ILE CD1 HD12 sing N N 147 
ILE CD1 HD13 sing N N 148 
ILE OXT HXT  sing N N 149 
LEU N   CA   sing N N 150 
LEU N   H    sing N N 151 
LEU N   H2   sing N N 152 
LEU CA  C    sing N N 153 
LEU CA  CB   sing N N 154 
LEU CA  HA   sing N N 155 
LEU C   O    doub N N 156 
LEU C   OXT  sing N N 157 
LEU CB  CG   sing N N 158 
LEU CB  HB2  sing N N 159 
LEU CB  HB3  sing N N 160 
LEU CG  CD1  sing N N 161 
LEU CG  CD2  sing N N 162 
LEU CG  HG   sing N N 163 
LEU CD1 HD11 sing N N 164 
LEU CD1 HD12 sing N N 165 
LEU CD1 HD13 sing N N 166 
LEU CD2 HD21 sing N N 167 
LEU CD2 HD22 sing N N 168 
LEU CD2 HD23 sing N N 169 
LEU OXT HXT  sing N N 170 
LYS N   CA   sing N N 171 
LYS N   H    sing N N 172 
LYS N   H2   sing N N 173 
LYS CA  C    sing N N 174 
LYS CA  CB   sing N N 175 
LYS CA  HA   sing N N 176 
LYS C   O    doub N N 177 
LYS C   OXT  sing N N 178 
LYS CB  CG   sing N N 179 
LYS CB  HB2  sing N N 180 
LYS CB  HB3  sing N N 181 
LYS CG  CD   sing N N 182 
LYS CG  HG2  sing N N 183 
LYS CG  HG3  sing N N 184 
LYS CD  CE   sing N N 185 
LYS CD  HD2  sing N N 186 
LYS CD  HD3  sing N N 187 
LYS CE  NZ   sing N N 188 
LYS CE  HE2  sing N N 189 
LYS CE  HE3  sing N N 190 
LYS NZ  HZ1  sing N N 191 
LYS NZ  HZ2  sing N N 192 
LYS NZ  HZ3  sing N N 193 
LYS OXT HXT  sing N N 194 
PHE N   CA   sing N N 195 
PHE N   H    sing N N 196 
PHE N   H2   sing N N 197 
PHE CA  C    sing N N 198 
PHE CA  CB   sing N N 199 
PHE CA  HA   sing N N 200 
PHE C   O    doub N N 201 
PHE C   OXT  sing N N 202 
PHE CB  CG   sing N N 203 
PHE CB  HB2  sing N N 204 
PHE CB  HB3  sing N N 205 
PHE CG  CD1  doub Y N 206 
PHE CG  CD2  sing Y N 207 
PHE CD1 CE1  sing Y N 208 
PHE CD1 HD1  sing N N 209 
PHE CD2 CE2  doub Y N 210 
PHE CD2 HD2  sing N N 211 
PHE CE1 CZ   doub Y N 212 
PHE CE1 HE1  sing N N 213 
PHE CE2 CZ   sing Y N 214 
PHE CE2 HE2  sing N N 215 
PHE CZ  HZ   sing N N 216 
PHE OXT HXT  sing N N 217 
PRO N   CA   sing N N 218 
PRO N   CD   sing N N 219 
PRO N   H    sing N N 220 
PRO CA  C    sing N N 221 
PRO CA  CB   sing N N 222 
PRO CA  HA   sing N N 223 
PRO C   O    doub N N 224 
PRO C   OXT  sing N N 225 
PRO CB  CG   sing N N 226 
PRO CB  HB2  sing N N 227 
PRO CB  HB3  sing N N 228 
PRO CG  CD   sing N N 229 
PRO CG  HG2  sing N N 230 
PRO CG  HG3  sing N N 231 
PRO CD  HD2  sing N N 232 
PRO CD  HD3  sing N N 233 
PRO OXT HXT  sing N N 234 
SER N   CA   sing N N 235 
SER N   H    sing N N 236 
SER N   H2   sing N N 237 
SER CA  C    sing N N 238 
SER CA  CB   sing N N 239 
SER CA  HA   sing N N 240 
SER C   O    doub N N 241 
SER C   OXT  sing N N 242 
SER CB  OG   sing N N 243 
SER CB  HB2  sing N N 244 
SER CB  HB3  sing N N 245 
SER OG  HG   sing N N 246 
SER OXT HXT  sing N N 247 
THR N   CA   sing N N 248 
THR N   H    sing N N 249 
THR N   H2   sing N N 250 
THR CA  C    sing N N 251 
THR CA  CB   sing N N 252 
THR CA  HA   sing N N 253 
THR C   O    doub N N 254 
THR C   OXT  sing N N 255 
THR CB  OG1  sing N N 256 
THR CB  CG2  sing N N 257 
THR CB  HB   sing N N 258 
THR OG1 HG1  sing N N 259 
THR CG2 HG21 sing N N 260 
THR CG2 HG22 sing N N 261 
THR CG2 HG23 sing N N 262 
THR OXT HXT  sing N N 263 
TRP N   CA   sing N N 264 
TRP N   H    sing N N 265 
TRP N   H2   sing N N 266 
TRP CA  C    sing N N 267 
TRP CA  CB   sing N N 268 
TRP CA  HA   sing N N 269 
TRP C   O    doub N N 270 
TRP C   OXT  sing N N 271 
TRP CB  CG   sing N N 272 
TRP CB  HB2  sing N N 273 
TRP CB  HB3  sing N N 274 
TRP CG  CD1  doub Y N 275 
TRP CG  CD2  sing Y N 276 
TRP CD1 NE1  sing Y N 277 
TRP CD1 HD1  sing N N 278 
TRP CD2 CE2  doub Y N 279 
TRP CD2 CE3  sing Y N 280 
TRP NE1 CE2  sing Y N 281 
TRP NE1 HE1  sing N N 282 
TRP CE2 CZ2  sing Y N 283 
TRP CE3 CZ3  doub Y N 284 
TRP CE3 HE3  sing N N 285 
TRP CZ2 CH2  doub Y N 286 
TRP CZ2 HZ2  sing N N 287 
TRP CZ3 CH2  sing Y N 288 
TRP CZ3 HZ3  sing N N 289 
TRP CH2 HH2  sing N N 290 
TRP OXT HXT  sing N N 291 
TYR N   CA   sing N N 292 
TYR N   H    sing N N 293 
TYR N   H2   sing N N 294 
TYR CA  C    sing N N 295 
TYR CA  CB   sing N N 296 
TYR CA  HA   sing N N 297 
TYR C   O    doub N N 298 
TYR C   OXT  sing N N 299 
TYR CB  CG   sing N N 300 
TYR CB  HB2  sing N N 301 
TYR CB  HB3  sing N N 302 
TYR CG  CD1  doub Y N 303 
TYR CG  CD2  sing Y N 304 
TYR CD1 CE1  sing Y N 305 
TYR CD1 HD1  sing N N 306 
TYR CD2 CE2  doub Y N 307 
TYR CD2 HD2  sing N N 308 
TYR CE1 CZ   doub Y N 309 
TYR CE1 HE1  sing N N 310 
TYR CE2 CZ   sing Y N 311 
TYR CE2 HE2  sing N N 312 
TYR CZ  OH   sing N N 313 
TYR OH  HH   sing N N 314 
TYR OXT HXT  sing N N 315 
VAL N   CA   sing N N 316 
VAL N   H    sing N N 317 
VAL N   H2   sing N N 318 
VAL CA  C    sing N N 319 
VAL CA  CB   sing N N 320 
VAL CA  HA   sing N N 321 
VAL C   O    doub N N 322 
VAL C   OXT  sing N N 323 
VAL CB  CG1  sing N N 324 
VAL CB  CG2  sing N N 325 
VAL CB  HB   sing N N 326 
VAL CG1 HG11 sing N N 327 
VAL CG1 HG12 sing N N 328 
VAL CG1 HG13 sing N N 329 
VAL CG2 HG21 sing N N 330 
VAL CG2 HG22 sing N N 331 
VAL CG2 HG23 sing N N 332 
VAL OXT HXT  sing N N 333 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Varian INOVA' 
# 
_atom_sites.entry_id                    2LDS 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_