data_2LEK # _entry.id 2LEK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LEK pdb_00002lek 10.2210/pdb2lek/pdb RCSB RCSB102297 ? ? BMRB 16377 ? ? WWPDB D_1000102297 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2011-08-24 _pdbx_database_PDB_obs_spr.pdb_id 2LEK _pdbx_database_PDB_obs_spr.replace_pdb_id 2KL0 _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 16377 BMRB unspecified . RpR325 TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LEK _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-06-16 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ramelot, T.A.' 1 'Cort, J.R.' 2 'Lee, H.' 3 'Wang, H.' 4 'Ciccosanti, C.' 5 'Jiang, M.' 6 'Nair, R.' 7 'Rost, B.' 8 'Acton, T.B.' 9 'Xiao, R.' 10 'Swapna, G.' 11 'Everett, J.K.' 12 'Prestegard, J.H.' 13 'Montelione, G.T.' 14 'Kennedy, M.A.' 15 'Northeast Structural Genomics Consortium (NESG)' 16 # _citation.id primary _citation.title ;Solution NMR structure of a Thiamine Biosynthesis (ThiS) Protein RPA3574 from Rhodopseudomonas palustris. Northeast Structural Genomics Consortium target RpR325 ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ramelot, T.A.' 1 ? primary 'Cort, J.R.' 2 ? primary 'Wang, H.' 3 ? primary 'Ciccosanti, C.' 4 ? primary 'Jiang, M.' 5 ? primary 'Nair, R.' 6 ? primary 'Rost, B.' 7 ? primary 'Acton, T.B.' 8 ? primary 'Xiao, R.' 9 ? primary 'Swapna, G.' 10 ? primary 'Everett, J.K.' 11 ? primary 'Montelione, G.T.' 12 ? primary 'Kennedy, M.A.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative thiamin biosynthesis ThiS' _entity.formula_weight 8108.959 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MLVTINGEQREVQSASVAALMTELDCTDGHYAVALNYDVVPRGKWDETPVTAGDEIEILTPRQGGLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MLVTINGEQREVQSASVAALMTELDCTDGHYAVALNYDVVPRGKWDETPVTAGDEIEILTPRQGGLEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier RpR325 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 VAL n 1 4 THR n 1 5 ILE n 1 6 ASN n 1 7 GLY n 1 8 GLU n 1 9 GLN n 1 10 ARG n 1 11 GLU n 1 12 VAL n 1 13 GLN n 1 14 SER n 1 15 ALA n 1 16 SER n 1 17 VAL n 1 18 ALA n 1 19 ALA n 1 20 LEU n 1 21 MET n 1 22 THR n 1 23 GLU n 1 24 LEU n 1 25 ASP n 1 26 CYS n 1 27 THR n 1 28 ASP n 1 29 GLY n 1 30 HIS n 1 31 TYR n 1 32 ALA n 1 33 VAL n 1 34 ALA n 1 35 LEU n 1 36 ASN n 1 37 TYR n 1 38 ASP n 1 39 VAL n 1 40 VAL n 1 41 PRO n 1 42 ARG n 1 43 GLY n 1 44 LYS n 1 45 TRP n 1 46 ASP n 1 47 GLU n 1 48 THR n 1 49 PRO n 1 50 VAL n 1 51 THR n 1 52 ALA n 1 53 GLY n 1 54 ASP n 1 55 GLU n 1 56 ILE n 1 57 GLU n 1 58 ILE n 1 59 LEU n 1 60 THR n 1 61 PRO n 1 62 ARG n 1 63 GLN n 1 64 GLY n 1 65 GLY n 1 66 LEU n 1 67 GLU n 1 68 HIS n 1 69 HIS n 1 70 HIS n 1 71 HIS n 1 72 HIS n 1 73 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'thiS, RPA3574' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rhodopseudomonas palustris' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1076 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) PMGK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET21-23C _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6N3W8_RHOPA _struct_ref.pdbx_db_accession Q6N3W8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MLVTINGEQREVQSASVAALMTELDCTGGHFAVALNYDVVPRGKWDETPVTAGDEIEILTPRQGG _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LEK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 65 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6N3W8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 65 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 65 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LEK ASP A 28 ? UNP Q6N3W8 GLY 28 conflict 28 1 1 2LEK TYR A 31 ? UNP Q6N3W8 PHE 31 conflict 31 2 1 2LEK LEU A 66 ? UNP Q6N3W8 ? ? 'expression tag' 66 3 1 2LEK GLU A 67 ? UNP Q6N3W8 ? ? 'expression tag' 67 4 1 2LEK HIS A 68 ? UNP Q6N3W8 ? ? 'expression tag' 68 5 1 2LEK HIS A 69 ? UNP Q6N3W8 ? ? 'expression tag' 69 6 1 2LEK HIS A 70 ? UNP Q6N3W8 ? ? 'expression tag' 70 7 1 2LEK HIS A 71 ? UNP Q6N3W8 ? ? 'expression tag' 71 8 1 2LEK HIS A 72 ? UNP Q6N3W8 ? ? 'expression tag' 72 9 1 2LEK HIS A 73 ? UNP Q6N3W8 ? ? 'expression tag' 73 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 2 '2D 1H-13C HSQC-CT' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '3D 1H-13C NOESY_aliph' 1 7 1 '3D HNCO' 1 8 1 '3D HNCACB' 1 9 1 '3D CBCA(CO)NH' 1 10 1 '3D 1H-13C NOESY_arom' 1 11 1 '3D HBHA(CO)NH' 1 12 1 '3D C(CCO)NH' 1 13 1 '3D HCCH-TOCSY' 1 14 3 '3D CCH-TOCSY' 1 15 1 '2D 1H-15N HSQC_His' 1 16 1 '3D HNCA' 1 17 1 '3D HN(CO)CA' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.9 mM [U-100% 13C; U-100% 15N] protein, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 0.02 % sodium azide, 10 mM DTT, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.8 mM U-100% 15N and 5% 13C biosynthetically directed protein, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 10 mM DTT, 0.02 % sodium azide, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' ;0.9 mM [U-100% 13C; U-100% 15N] protein, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 0.02 % sodium azide, 10 mM DTT, 100% D2O ; 3 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 850 Bruker 'AVANCE III' 2 'Bruker Avance III' 500 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LEK _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'CNS water refinement' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LEK _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LEK _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2008 1 Varian collection VNMR 6.1C 2 'Bruker Biospin' collection TopSpin 2.1.4 3 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.2.1 4 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 2.25 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.3 6 Goddard 'data analysis' Sparky 3.113 7 'Bhattacharya and Montelione' refinement PSVS 1.4 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.30 9 '(PdbStat)-Roberto Tejero and Gaetano T. Montelione' 'structure solution' PdbStat 5.4 10 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift autoassignment' 'PINE Server' 1.0 11 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 12 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LEK _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LEK _struct.title ;Solution NMR structure of a Thiamine Biosynthesis (ThiS) Protein RPA3574 from Rhodopseudomonas palustris refined with NH RDCs. Northeast Structural Genomics Consortium target RpR325 ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LEK _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' _struct_keywords.text ;beta-grasp fold, Structural Genomics, Northeast Structural Genomics Consortium, NESG, PSI-Biology, Protein Structure Initiative, BIOSYNTHETIC PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 16 ? LEU A 24 ? SER A 16 LEU A 24 1 ? 9 HELX_P HELX_P2 2 PRO A 41 ? TRP A 45 ? PRO A 41 TRP A 45 5 ? 5 HELX_P HELX_P3 3 LEU A 66 ? HIS A 70 ? LEU A 66 HIS A 70 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 8 ? GLU A 11 ? GLU A 8 GLU A 11 A 2 LEU A 2 ? ILE A 5 ? LEU A 2 ILE A 5 A 3 GLU A 55 ? LEU A 59 ? GLU A 55 LEU A 59 A 4 ALA A 32 ? LEU A 35 ? ALA A 32 LEU A 35 A 5 ASP A 38 ? VAL A 40 ? ASP A 38 VAL A 40 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 8 ? O GLU A 8 N ILE A 5 ? N ILE A 5 A 2 3 N THR A 4 ? N THR A 4 O ILE A 56 ? O ILE A 56 A 3 4 O GLU A 57 ? O GLU A 57 N ALA A 34 ? N ALA A 34 A 4 5 N LEU A 35 ? N LEU A 35 O ASP A 38 ? O ASP A 38 # _atom_sites.entry_id 2LEK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 TRP 45 45 45 TRP TRP A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 HIS 73 73 73 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-06-29 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-02-22 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' 6 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 0.9 ? mM '[U-100% 13C; U-100% 15N]' 1 MES-2 20 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 'calcium chloride-4' 5 ? mM ? 1 'sodium azide-5' 0.02 ? % ? 1 DTT-6 10 ? mM ? 1 protein-7 0.8 ? mM 'U-100% 15N and 5% 13C biosynthetically directed' 2 MES-8 20 ? mM ? 2 'sodium chloride-9' 100 ? mM ? 2 'calcium chloride-10' 5 ? mM ? 2 DTT-11 10 ? mM ? 2 'sodium azide-12' 0.02 ? % ? 2 protein-13 0.9 ? mM '[U-100% 13C; U-100% 15N]' 3 MES-14 20 ? mM ? 3 'sodium chloride-15' 100 ? mM ? 3 'calcium chloride-16' 5 ? mM ? 3 'sodium azide-17' 0.02 ? % ? 3 DTT-18 10 ? mM ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 26 ? ? -92.48 38.17 2 1 HIS A 30 ? ? -154.78 86.10 3 1 TYR A 37 ? ? 72.89 -5.86 4 1 HIS A 70 ? ? -160.74 118.13 5 3 CYS A 26 ? ? -92.75 34.56 6 3 HIS A 71 ? ? -122.18 -62.05 7 4 CYS A 26 ? ? -95.50 33.52 8 4 TYR A 37 ? ? 73.91 -9.28 9 4 ARG A 62 ? ? 59.50 72.90 10 4 HIS A 72 ? ? 59.03 84.83 11 5 CYS A 26 ? ? -88.98 40.95 12 5 TYR A 37 ? ? 74.89 -16.80 13 5 THR A 60 ? ? -119.00 67.84 14 5 HIS A 70 ? ? 47.87 106.95 15 5 HIS A 72 ? ? 54.34 93.53 16 6 GLU A 67 ? ? -68.73 93.33 17 6 HIS A 68 ? ? 74.74 -77.19 18 7 GLU A 67 ? ? -88.01 32.10 19 8 ALA A 15 ? ? 75.45 -43.17 20 8 ARG A 62 ? ? 70.66 115.99 21 8 HIS A 69 ? ? -56.62 102.52 22 9 TYR A 37 ? ? 74.02 -2.03 23 9 ARG A 62 ? ? -65.91 99.96 24 9 GLN A 63 ? ? 59.80 77.83 25 9 LEU A 66 ? ? -68.24 99.69 26 9 HIS A 71 ? ? -174.38 131.98 27 10 HIS A 30 ? ? 56.18 72.56 28 10 GLN A 63 ? ? 81.25 -62.33 29 10 HIS A 72 ? ? 69.59 171.51 30 11 TYR A 37 ? ? 71.18 -2.10 31 11 ARG A 62 ? ? 70.46 78.11 32 11 HIS A 69 ? ? -69.29 91.01 33 12 ALA A 15 ? ? 77.02 -50.33 34 12 CYS A 26 ? ? -96.92 37.71 35 12 GLN A 63 ? ? 82.86 -56.61 36 12 HIS A 69 ? ? 72.42 117.40 37 12 HIS A 71 ? ? -67.57 89.32 38 13 ARG A 62 ? ? -111.97 -78.99 39 13 HIS A 69 ? ? 57.78 -83.19 40 13 HIS A 70 ? ? 63.06 -153.71 41 14 SER A 14 ? ? -57.46 100.07 42 14 CYS A 26 ? ? -96.36 40.68 43 14 ASP A 28 ? ? -57.52 109.02 44 14 LEU A 66 ? ? -156.36 80.33 45 14 HIS A 69 ? ? -84.07 45.07 46 15 ARG A 62 ? ? 60.08 77.17 47 15 GLN A 63 ? ? -145.11 -49.35 48 15 GLU A 67 ? ? -54.62 92.81 49 15 HIS A 69 ? ? -164.35 104.57 50 16 CYS A 26 ? ? -92.78 36.92 51 16 TYR A 37 ? ? 72.49 30.68 52 16 ARG A 62 ? ? -155.38 -0.72 53 16 HIS A 68 ? ? -65.04 91.30 54 16 HIS A 72 ? ? -96.98 -69.08 55 17 GLN A 13 ? ? -149.89 18.16 56 17 ALA A 15 ? ? 75.79 -46.69 57 17 ARG A 62 ? ? -166.15 -79.55 58 17 GLN A 63 ? ? 71.14 -75.45 59 17 LEU A 66 ? ? 62.11 81.23 60 17 HIS A 70 ? ? 65.56 99.29 61 18 TYR A 37 ? ? 73.44 -9.88 62 18 HIS A 70 ? ? -174.78 30.92 63 19 SER A 14 ? ? -67.07 99.37 64 19 TYR A 37 ? ? 79.26 -17.04 65 19 ARG A 62 ? ? -62.84 86.92 66 19 GLN A 63 ? ? 173.44 -61.27 67 19 GLU A 67 ? ? -64.60 81.29 68 19 HIS A 69 ? ? -62.15 87.80 69 19 HIS A 72 ? ? -179.64 -46.82 70 20 ARG A 62 ? ? 72.40 -3.04 71 20 LEU A 66 ? ? -56.47 -72.50 72 20 HIS A 68 ? ? -40.28 99.37 73 20 HIS A 72 ? ? 74.75 -60.33 #