data_2LFK # _entry.id 2LFK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.382 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LFK pdb_00002lfk 10.2210/pdb2lfk/pdb RCSB RCSB102330 ? ? BMRB 17763 ? ? WWPDB D_1000102330 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17763 BMRB unspecified . 2LFL PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LFK _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-07-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bronsoms, S.' 1 'Pantoja-Uceda, D.' 2 'Gabrijelcic-Geiger, D.' 3 'Sanglas, L.' 4 'Aviles, F.' 5 'Santoro, J.' 6 'Sommerhoff, C.' 7 'Arolas, J.' 8 # _citation.id primary _citation.title 'Oxidative folding and structural analyses of a kunitz-related inhibitor and its disulfide intermediates: functional implications.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 414 _citation.page_first 427 _citation.page_last 441 _citation.year 2011 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22033478 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2011.10.018 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bronsoms, S.' 1 ? primary 'Pantoja-Uceda, D.' 2 ? primary 'Gabrijelcic-Geiger, D.' 3 ? primary 'Sanglas, L.' 4 ? primary 'Aviles, F.X.' 5 ? primary 'Santoro, J.' 6 ? primary 'Sommerhoff, C.P.' 7 ? primary 'Arolas, J.L.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Tryptase inhibitor' _entity.formula_weight 6337.299 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues 42-96' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GDKEECTVPIGWSEPVKGLCKARFTRYYCMGNCCKVYEGCYTGGYSRMGECARNCPG _entity_poly.pdbx_seq_one_letter_code_can GDKEECTVPIGWSEPVKGLCKARFTRYYCMGNCCKVYEGCYTGGYSRMGECARNCPG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASP n 1 3 LYS n 1 4 GLU n 1 5 GLU n 1 6 CYS n 1 7 THR n 1 8 VAL n 1 9 PRO n 1 10 ILE n 1 11 GLY n 1 12 TRP n 1 13 SER n 1 14 GLU n 1 15 PRO n 1 16 VAL n 1 17 LYS n 1 18 GLY n 1 19 LEU n 1 20 CYS n 1 21 LYS n 1 22 ALA n 1 23 ARG n 1 24 PHE n 1 25 THR n 1 26 ARG n 1 27 TYR n 1 28 TYR n 1 29 CYS n 1 30 MET n 1 31 GLY n 1 32 ASN n 1 33 CYS n 1 34 CYS n 1 35 LYS n 1 36 VAL n 1 37 TYR n 1 38 GLU n 1 39 GLY n 1 40 CYS n 1 41 TYR n 1 42 THR n 1 43 GLY n 1 44 GLY n 1 45 TYR n 1 46 SER n 1 47 ARG n 1 48 MET n 1 49 GLY n 1 50 GLU n 1 51 CYS n 1 52 ALA n 1 53 ARG n 1 54 ASN n 1 55 CYS n 1 56 PRO n 1 57 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Brown ear tick' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rhipicephalus appendiculatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 34631 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET-32a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q1EG59_RHIAP _struct_ref.pdbx_db_accession Q1EG59 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KEECTVPIGWSEPVKGLCKARFTRYYCMGNCCKVYEGCYTGGYSRMGECARNCPG _struct_ref.pdbx_align_begin 42 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LFK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 57 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q1EG59 _struct_ref_seq.db_align_beg 42 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 96 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 21 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LFK GLY A 1 ? UNP Q1EG59 ? ? 'expression tag' 19 1 1 2LFK ASP A 2 ? UNP Q1EG59 ? ? 'expression tag' 20 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H COSY' 1 2 1 '2D 1H-1H NOESY' 1 3 1 '2D 1H-1H TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 2.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.0 mM TdPI-short, 90% H2O/10% D2O 0.1% TFA' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O 0.1% TFA' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LFK _pdbx_nmr_refine.method 'molecular dynamics, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LFK _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LFK _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, and Kollm' refinement Amber 9.0 2 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView 5.0.20 3 'Johnson, One Moon Scientific' 'data analysis' NMRView 5.0.20 4 'Johnson, One Moon Scientific' 'peak picking' NMRView 5.0.20 5 'Bruker Biospin' collection TopSpin 1.3 6 'Bruker Biospin' processing TopSpin 1.3 7 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LFK _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LFK _struct.title 'NMR solution structure of native TdPI-short' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LFK _struct_keywords.pdbx_keywords 'HYDROLASE INHIBITOR' _struct_keywords.text 'HYDROLASE INHIBITOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 47 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 52 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 65 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 70 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 24 A CYS 51 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf2 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 40 SG ? ? A CYS 38 A CYS 58 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf3 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 55 SG ? ? A CYS 47 A CYS 73 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf4 disulf ? ? A CYS 34 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 52 A CYS 69 1_555 ? ? ? ? ? ? ? 2.036 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 25 ? MET A 30 ? THR A 43 MET A 48 A 2 CYS A 33 ? GLU A 38 ? CYS A 51 GLU A 56 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 26 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 44 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 37 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 55 # _atom_sites.entry_id 2LFK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 19 19 GLY GLY A . n A 1 2 ASP 2 20 20 ASP ASP A . n A 1 3 LYS 3 21 21 LYS LYS A . n A 1 4 GLU 4 22 22 GLU GLU A . n A 1 5 GLU 5 23 23 GLU GLU A . n A 1 6 CYS 6 24 24 CYS CYS A . n A 1 7 THR 7 25 25 THR THR A . n A 1 8 VAL 8 26 26 VAL VAL A . n A 1 9 PRO 9 27 27 PRO PRO A . n A 1 10 ILE 10 28 28 ILE ILE A . n A 1 11 GLY 11 29 29 GLY GLY A . n A 1 12 TRP 12 30 30 TRP TRP A . n A 1 13 SER 13 31 31 SER SER A . n A 1 14 GLU 14 32 32 GLU GLU A . n A 1 15 PRO 15 33 33 PRO PRO A . n A 1 16 VAL 16 34 34 VAL VAL A . n A 1 17 LYS 17 35 35 LYS LYS A . n A 1 18 GLY 18 36 36 GLY GLY A . n A 1 19 LEU 19 37 37 LEU LEU A . n A 1 20 CYS 20 38 38 CYS CYS A . n A 1 21 LYS 21 39 39 LYS LYS A . n A 1 22 ALA 22 40 40 ALA ALA A . n A 1 23 ARG 23 41 41 ARG ARG A . n A 1 24 PHE 24 42 42 PHE PHE A . n A 1 25 THR 25 43 43 THR THR A . n A 1 26 ARG 26 44 44 ARG ARG A . n A 1 27 TYR 27 45 45 TYR TYR A . n A 1 28 TYR 28 46 46 TYR TYR A . n A 1 29 CYS 29 47 47 CYS CYS A . n A 1 30 MET 30 48 48 MET MET A . n A 1 31 GLY 31 49 49 GLY GLY A . n A 1 32 ASN 32 50 50 ASN ASN A . n A 1 33 CYS 33 51 51 CYS CYS A . n A 1 34 CYS 34 52 52 CYS CYS A . n A 1 35 LYS 35 53 53 LYS LYS A . n A 1 36 VAL 36 54 54 VAL VAL A . n A 1 37 TYR 37 55 55 TYR TYR A . n A 1 38 GLU 38 56 56 GLU GLU A . n A 1 39 GLY 39 57 57 GLY GLY A . n A 1 40 CYS 40 58 58 CYS CYS A . n A 1 41 TYR 41 59 59 TYR TYR A . n A 1 42 THR 42 60 60 THR THR A . n A 1 43 GLY 43 61 61 GLY GLY A . n A 1 44 GLY 44 62 62 GLY GLY A . n A 1 45 TYR 45 63 63 TYR TYR A . n A 1 46 SER 46 64 64 SER SER A . n A 1 47 ARG 47 65 65 ARG ARG A . n A 1 48 MET 48 66 66 MET MET A . n A 1 49 GLY 49 67 67 GLY GLY A . n A 1 50 GLU 50 68 68 GLU GLU A . n A 1 51 CYS 51 69 69 CYS CYS A . n A 1 52 ALA 52 70 70 ALA ALA A . n A 1 53 ARG 53 71 71 ARG ARG A . n A 1 54 ASN 54 72 72 ASN ASN A . n A 1 55 CYS 55 73 73 CYS CYS A . n A 1 56 PRO 56 74 74 PRO PRO A . n A 1 57 GLY 57 75 75 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-11-09 2 'Structure model' 1 1 2011-12-28 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2023-12-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_conn 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' struct_conn 10 4 'Structure model' struct_conn_type # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_exptl_sample.component TdPI-short-1 _pdbx_nmr_exptl_sample.concentration 1.0 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LFK _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 711 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 403 _pdbx_nmr_constraints.NOE_long_range_total_count 12 _pdbx_nmr_constraints.NOE_medium_range_total_count 189 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 119 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 7 NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 123.45 120.30 3.15 0.50 N 2 15 NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 123.30 120.30 3.00 0.50 N 3 17 NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 123.30 120.30 3.00 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 60 ? ? 50.75 -10.32 2 3 THR A 60 ? ? 50.74 3.53 3 4 GLU A 22 ? ? -141.09 15.51 4 5 CYS A 24 ? ? -119.09 59.38 5 5 LEU A 37 ? ? 57.19 17.89 6 5 CYS A 58 ? ? -69.73 71.19 7 6 LEU A 37 ? ? 59.35 9.07 8 7 GLU A 22 ? ? -67.62 14.60 9 7 LEU A 37 ? ? 57.84 17.18 10 7 ASN A 50 ? ? 58.44 9.32 11 10 CYS A 47 ? ? -69.36 96.44 12 11 THR A 60 ? ? 54.20 -13.58 13 12 ASN A 50 ? ? 59.23 14.05 14 14 CYS A 24 ? ? -97.78 45.48 15 14 LEU A 37 ? ? 55.13 18.07 16 14 TYR A 55 ? ? -109.44 -68.76 17 14 GLU A 56 ? ? 67.83 78.57 18 14 CYS A 58 ? ? 77.07 91.98 19 14 TYR A 59 ? ? -135.30 -56.94 20 14 THR A 60 ? ? 54.84 -2.31 21 16 ASN A 50 ? ? 63.67 -1.27 22 16 CYS A 58 ? ? 95.87 90.04 23 16 ASN A 72 ? ? -125.36 -52.77 24 17 CYS A 24 ? ? -106.73 45.72 25 17 VAL A 26 ? ? 55.23 81.52 26 17 ASN A 50 ? ? -152.19 -48.46 27 17 THR A 60 ? ? 50.83 -8.38 28 18 LEU A 37 ? ? 53.85 19.35 29 19 VAL A 26 ? ? 47.70 75.47 30 19 ASN A 50 ? ? 47.09 28.05 31 20 LEU A 37 ? ? 57.50 17.92 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 ILE N N N N 117 ILE CA C N S 118 ILE C C N N 119 ILE O O N N 120 ILE CB C N S 121 ILE CG1 C N N 122 ILE CG2 C N N 123 ILE CD1 C N N 124 ILE OXT O N N 125 ILE H H N N 126 ILE H2 H N N 127 ILE HA H N N 128 ILE HB H N N 129 ILE HG12 H N N 130 ILE HG13 H N N 131 ILE HG21 H N N 132 ILE HG22 H N N 133 ILE HG23 H N N 134 ILE HD11 H N N 135 ILE HD12 H N N 136 ILE HD13 H N N 137 ILE HXT H N N 138 LEU N N N N 139 LEU CA C N S 140 LEU C C N N 141 LEU O O N N 142 LEU CB C N N 143 LEU CG C N N 144 LEU CD1 C N N 145 LEU CD2 C N N 146 LEU OXT O N N 147 LEU H H N N 148 LEU H2 H N N 149 LEU HA H N N 150 LEU HB2 H N N 151 LEU HB3 H N N 152 LEU HG H N N 153 LEU HD11 H N N 154 LEU HD12 H N N 155 LEU HD13 H N N 156 LEU HD21 H N N 157 LEU HD22 H N N 158 LEU HD23 H N N 159 LEU HXT H N N 160 LYS N N N N 161 LYS CA C N S 162 LYS C C N N 163 LYS O O N N 164 LYS CB C N N 165 LYS CG C N N 166 LYS CD C N N 167 LYS CE C N N 168 LYS NZ N N N 169 LYS OXT O N N 170 LYS H H N N 171 LYS H2 H N N 172 LYS HA H N N 173 LYS HB2 H N N 174 LYS HB3 H N N 175 LYS HG2 H N N 176 LYS HG3 H N N 177 LYS HD2 H N N 178 LYS HD3 H N N 179 LYS HE2 H N N 180 LYS HE3 H N N 181 LYS HZ1 H N N 182 LYS HZ2 H N N 183 LYS HZ3 H N N 184 LYS HXT H N N 185 MET N N N N 186 MET CA C N S 187 MET C C N N 188 MET O O N N 189 MET CB C N N 190 MET CG C N N 191 MET SD S N N 192 MET CE C N N 193 MET OXT O N N 194 MET H H N N 195 MET H2 H N N 196 MET HA H N N 197 MET HB2 H N N 198 MET HB3 H N N 199 MET HG2 H N N 200 MET HG3 H N N 201 MET HE1 H N N 202 MET HE2 H N N 203 MET HE3 H N N 204 MET HXT H N N 205 PHE N N N N 206 PHE CA C N S 207 PHE C C N N 208 PHE O O N N 209 PHE CB C N N 210 PHE CG C Y N 211 PHE CD1 C Y N 212 PHE CD2 C Y N 213 PHE CE1 C Y N 214 PHE CE2 C Y N 215 PHE CZ C Y N 216 PHE OXT O N N 217 PHE H H N N 218 PHE H2 H N N 219 PHE HA H N N 220 PHE HB2 H N N 221 PHE HB3 H N N 222 PHE HD1 H N N 223 PHE HD2 H N N 224 PHE HE1 H N N 225 PHE HE2 H N N 226 PHE HZ H N N 227 PHE HXT H N N 228 PRO N N N N 229 PRO CA C N S 230 PRO C C N N 231 PRO O O N N 232 PRO CB C N N 233 PRO CG C N N 234 PRO CD C N N 235 PRO OXT O N N 236 PRO H H N N 237 PRO HA H N N 238 PRO HB2 H N N 239 PRO HB3 H N N 240 PRO HG2 H N N 241 PRO HG3 H N N 242 PRO HD2 H N N 243 PRO HD3 H N N 244 PRO HXT H N N 245 SER N N N N 246 SER CA C N S 247 SER C C N N 248 SER O O N N 249 SER CB C N N 250 SER OG O N N 251 SER OXT O N N 252 SER H H N N 253 SER H2 H N N 254 SER HA H N N 255 SER HB2 H N N 256 SER HB3 H N N 257 SER HG H N N 258 SER HXT H N N 259 THR N N N N 260 THR CA C N S 261 THR C C N N 262 THR O O N N 263 THR CB C N R 264 THR OG1 O N N 265 THR CG2 C N N 266 THR OXT O N N 267 THR H H N N 268 THR H2 H N N 269 THR HA H N N 270 THR HB H N N 271 THR HG1 H N N 272 THR HG21 H N N 273 THR HG22 H N N 274 THR HG23 H N N 275 THR HXT H N N 276 TRP N N N N 277 TRP CA C N S 278 TRP C C N N 279 TRP O O N N 280 TRP CB C N N 281 TRP CG C Y N 282 TRP CD1 C Y N 283 TRP CD2 C Y N 284 TRP NE1 N Y N 285 TRP CE2 C Y N 286 TRP CE3 C Y N 287 TRP CZ2 C Y N 288 TRP CZ3 C Y N 289 TRP CH2 C Y N 290 TRP OXT O N N 291 TRP H H N N 292 TRP H2 H N N 293 TRP HA H N N 294 TRP HB2 H N N 295 TRP HB3 H N N 296 TRP HD1 H N N 297 TRP HE1 H N N 298 TRP HE3 H N N 299 TRP HZ2 H N N 300 TRP HZ3 H N N 301 TRP HH2 H N N 302 TRP HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 ILE N CA sing N N 110 ILE N H sing N N 111 ILE N H2 sing N N 112 ILE CA C sing N N 113 ILE CA CB sing N N 114 ILE CA HA sing N N 115 ILE C O doub N N 116 ILE C OXT sing N N 117 ILE CB CG1 sing N N 118 ILE CB CG2 sing N N 119 ILE CB HB sing N N 120 ILE CG1 CD1 sing N N 121 ILE CG1 HG12 sing N N 122 ILE CG1 HG13 sing N N 123 ILE CG2 HG21 sing N N 124 ILE CG2 HG22 sing N N 125 ILE CG2 HG23 sing N N 126 ILE CD1 HD11 sing N N 127 ILE CD1 HD12 sing N N 128 ILE CD1 HD13 sing N N 129 ILE OXT HXT sing N N 130 LEU N CA sing N N 131 LEU N H sing N N 132 LEU N H2 sing N N 133 LEU CA C sing N N 134 LEU CA CB sing N N 135 LEU CA HA sing N N 136 LEU C O doub N N 137 LEU C OXT sing N N 138 LEU CB CG sing N N 139 LEU CB HB2 sing N N 140 LEU CB HB3 sing N N 141 LEU CG CD1 sing N N 142 LEU CG CD2 sing N N 143 LEU CG HG sing N N 144 LEU CD1 HD11 sing N N 145 LEU CD1 HD12 sing N N 146 LEU CD1 HD13 sing N N 147 LEU CD2 HD21 sing N N 148 LEU CD2 HD22 sing N N 149 LEU CD2 HD23 sing N N 150 LEU OXT HXT sing N N 151 LYS N CA sing N N 152 LYS N H sing N N 153 LYS N H2 sing N N 154 LYS CA C sing N N 155 LYS CA CB sing N N 156 LYS CA HA sing N N 157 LYS C O doub N N 158 LYS C OXT sing N N 159 LYS CB CG sing N N 160 LYS CB HB2 sing N N 161 LYS CB HB3 sing N N 162 LYS CG CD sing N N 163 LYS CG HG2 sing N N 164 LYS CG HG3 sing N N 165 LYS CD CE sing N N 166 LYS CD HD2 sing N N 167 LYS CD HD3 sing N N 168 LYS CE NZ sing N N 169 LYS CE HE2 sing N N 170 LYS CE HE3 sing N N 171 LYS NZ HZ1 sing N N 172 LYS NZ HZ2 sing N N 173 LYS NZ HZ3 sing N N 174 LYS OXT HXT sing N N 175 MET N CA sing N N 176 MET N H sing N N 177 MET N H2 sing N N 178 MET CA C sing N N 179 MET CA CB sing N N 180 MET CA HA sing N N 181 MET C O doub N N 182 MET C OXT sing N N 183 MET CB CG sing N N 184 MET CB HB2 sing N N 185 MET CB HB3 sing N N 186 MET CG SD sing N N 187 MET CG HG2 sing N N 188 MET CG HG3 sing N N 189 MET SD CE sing N N 190 MET CE HE1 sing N N 191 MET CE HE2 sing N N 192 MET CE HE3 sing N N 193 MET OXT HXT sing N N 194 PHE N CA sing N N 195 PHE N H sing N N 196 PHE N H2 sing N N 197 PHE CA C sing N N 198 PHE CA CB sing N N 199 PHE CA HA sing N N 200 PHE C O doub N N 201 PHE C OXT sing N N 202 PHE CB CG sing N N 203 PHE CB HB2 sing N N 204 PHE CB HB3 sing N N 205 PHE CG CD1 doub Y N 206 PHE CG CD2 sing Y N 207 PHE CD1 CE1 sing Y N 208 PHE CD1 HD1 sing N N 209 PHE CD2 CE2 doub Y N 210 PHE CD2 HD2 sing N N 211 PHE CE1 CZ doub Y N 212 PHE CE1 HE1 sing N N 213 PHE CE2 CZ sing Y N 214 PHE CE2 HE2 sing N N 215 PHE CZ HZ sing N N 216 PHE OXT HXT sing N N 217 PRO N CA sing N N 218 PRO N CD sing N N 219 PRO N H sing N N 220 PRO CA C sing N N 221 PRO CA CB sing N N 222 PRO CA HA sing N N 223 PRO C O doub N N 224 PRO C OXT sing N N 225 PRO CB CG sing N N 226 PRO CB HB2 sing N N 227 PRO CB HB3 sing N N 228 PRO CG CD sing N N 229 PRO CG HG2 sing N N 230 PRO CG HG3 sing N N 231 PRO CD HD2 sing N N 232 PRO CD HD3 sing N N 233 PRO OXT HXT sing N N 234 SER N CA sing N N 235 SER N H sing N N 236 SER N H2 sing N N 237 SER CA C sing N N 238 SER CA CB sing N N 239 SER CA HA sing N N 240 SER C O doub N N 241 SER C OXT sing N N 242 SER CB OG sing N N 243 SER CB HB2 sing N N 244 SER CB HB3 sing N N 245 SER OG HG sing N N 246 SER OXT HXT sing N N 247 THR N CA sing N N 248 THR N H sing N N 249 THR N H2 sing N N 250 THR CA C sing N N 251 THR CA CB sing N N 252 THR CA HA sing N N 253 THR C O doub N N 254 THR C OXT sing N N 255 THR CB OG1 sing N N 256 THR CB CG2 sing N N 257 THR CB HB sing N N 258 THR OG1 HG1 sing N N 259 THR CG2 HG21 sing N N 260 THR CG2 HG22 sing N N 261 THR CG2 HG23 sing N N 262 THR OXT HXT sing N N 263 TRP N CA sing N N 264 TRP N H sing N N 265 TRP N H2 sing N N 266 TRP CA C sing N N 267 TRP CA CB sing N N 268 TRP CA HA sing N N 269 TRP C O doub N N 270 TRP C OXT sing N N 271 TRP CB CG sing N N 272 TRP CB HB2 sing N N 273 TRP CB HB3 sing N N 274 TRP CG CD1 doub Y N 275 TRP CG CD2 sing Y N 276 TRP CD1 NE1 sing Y N 277 TRP CD1 HD1 sing N N 278 TRP CD2 CE2 doub Y N 279 TRP CD2 CE3 sing Y N 280 TRP NE1 CE2 sing Y N 281 TRP NE1 HE1 sing N N 282 TRP CE2 CZ2 sing Y N 283 TRP CE3 CZ3 doub Y N 284 TRP CE3 HE3 sing N N 285 TRP CZ2 CH2 doub Y N 286 TRP CZ2 HZ2 sing N N 287 TRP CZ3 CH2 sing Y N 288 TRP CZ3 HZ3 sing N N 289 TRP CH2 HH2 sing N N 290 TRP OXT HXT sing N N 291 TYR N CA sing N N 292 TYR N H sing N N 293 TYR N H2 sing N N 294 TYR CA C sing N N 295 TYR CA CB sing N N 296 TYR CA HA sing N N 297 TYR C O doub N N 298 TYR C OXT sing N N 299 TYR CB CG sing N N 300 TYR CB HB2 sing N N 301 TYR CB HB3 sing N N 302 TYR CG CD1 doub Y N 303 TYR CG CD2 sing Y N 304 TYR CD1 CE1 sing Y N 305 TYR CD1 HD1 sing N N 306 TYR CD2 CE2 doub Y N 307 TYR CD2 HD2 sing N N 308 TYR CE1 CZ doub Y N 309 TYR CE1 HE1 sing N N 310 TYR CE2 CZ sing Y N 311 TYR CE2 HE2 sing N N 312 TYR CZ OH sing N N 313 TYR OH HH sing N N 314 TYR OXT HXT sing N N 315 VAL N CA sing N N 316 VAL N H sing N N 317 VAL N H2 sing N N 318 VAL CA C sing N N 319 VAL CA CB sing N N 320 VAL CA HA sing N N 321 VAL C O doub N N 322 VAL C OXT sing N N 323 VAL CB CG1 sing N N 324 VAL CB CG2 sing N N 325 VAL CB HB sing N N 326 VAL CG1 HG11 sing N N 327 VAL CG1 HG12 sing N N 328 VAL CG1 HG13 sing N N 329 VAL CG2 HG21 sing N N 330 VAL CG2 HG22 sing N N 331 VAL CG2 HG23 sing N N 332 VAL OXT HXT sing N N 333 #