data_2LFL # _entry.id 2LFL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LFL pdb_00002lfl 10.2210/pdb2lfl/pdb RCSB RCSB102331 ? ? BMRB 17763 ? ? WWPDB D_1000102331 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17763 BMRB unspecified . 2LFK PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LFL _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-07-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bronsoms, S.' 1 'Pantoja-Uceda, D.' 2 'Gabrijelcic-Geiger, D.' 3 'Sanglas, L.' 4 'Aviles, F.' 5 'Santoro, J.' 6 'Sommerhoff, C.' 7 'Arolas, J.' 8 # _citation.id primary _citation.title 'Oxidative folding and structural analyses of a kunitz-related inhibitor and its disulfide intermediates: functional implications.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 414 _citation.page_first 427 _citation.page_last 441 _citation.year 2011 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22033478 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2011.10.018 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bronsoms, S.' 1 ? primary 'Pantoja-Uceda, D.' 2 ? primary 'Gabrijelcic-Geiger, D.' 3 ? primary 'Sanglas, L.' 4 ? primary 'Aviles, F.X.' 5 ? primary 'Santoro, J.' 6 ? primary 'Sommerhoff, C.P.' 7 ? primary 'Arolas, J.L.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Tryptase inhibitor' _entity.formula_weight 6337.299 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues 42-96' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GDKEECTVPIGWSEPVKGLCKARFTRYYCMGNCCKVYEGCYTGGYSRMGECARNCPG _entity_poly.pdbx_seq_one_letter_code_can GDKEECTVPIGWSEPVKGLCKARFTRYYCMGNCCKVYEGCYTGGYSRMGECARNCPG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASP n 1 3 LYS n 1 4 GLU n 1 5 GLU n 1 6 CYS n 1 7 THR n 1 8 VAL n 1 9 PRO n 1 10 ILE n 1 11 GLY n 1 12 TRP n 1 13 SER n 1 14 GLU n 1 15 PRO n 1 16 VAL n 1 17 LYS n 1 18 GLY n 1 19 LEU n 1 20 CYS n 1 21 LYS n 1 22 ALA n 1 23 ARG n 1 24 PHE n 1 25 THR n 1 26 ARG n 1 27 TYR n 1 28 TYR n 1 29 CYS n 1 30 MET n 1 31 GLY n 1 32 ASN n 1 33 CYS n 1 34 CYS n 1 35 LYS n 1 36 VAL n 1 37 TYR n 1 38 GLU n 1 39 GLY n 1 40 CYS n 1 41 TYR n 1 42 THR n 1 43 GLY n 1 44 GLY n 1 45 TYR n 1 46 SER n 1 47 ARG n 1 48 MET n 1 49 GLY n 1 50 GLU n 1 51 CYS n 1 52 ALA n 1 53 ARG n 1 54 ASN n 1 55 CYS n 1 56 PRO n 1 57 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Brown ear tick' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rhipicephalus appendiculatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 34631 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET-32a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q1EG59_RHIAP _struct_ref.pdbx_db_accession Q1EG59 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KEECTVPIGWSEPVKGLCKARFTRYYCMGNCCKVYEGCYTGGYSRMGECARNCPG _struct_ref.pdbx_align_begin 42 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LFL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 57 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q1EG59 _struct_ref_seq.db_align_beg 42 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 96 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 21 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LFL GLY A 1 ? UNP Q1EG59 ? ? 'expression tag' 19 1 1 2LFL ASP A 2 ? UNP Q1EG59 ? ? 'expression tag' 20 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H COSY' 1 2 1 '2D 1H-1H NOESY' 1 3 1 '2D 1H-1H TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 2.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.0 mM TdPI-short, 90% H2O/10% D2O 0.1% TFA' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O 0.1% TFA' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LFL _pdbx_nmr_refine.method 'molecular dynamics, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LFL _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LFL _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, and Kollm' refinement Amber 9.0 2 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView 5.0.20 3 'Johnson, One Moon Scientific' 'data analysis' NMRView 5.0.20 4 'Johnson, One Moon Scientific' 'peak picking' NMRView 5.0.20 5 'Bruker Biospin' collection TopSpin 1.3 6 'Bruker Biospin' processing TopSpin 1.3 7 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LFL _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LFL _struct.title 'NMR solution structure of the intermediate IIIb of TdPI-short' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LFL _struct_keywords.pdbx_keywords 'HYDROLASE INHIBITOR' _struct_keywords.text 'HYDROLASE INHIBITOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 47 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 54 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 65 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 72 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 24 A CYS 51 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf2 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 55 SG ? ? A CYS 47 A CYS 73 1_555 ? ? ? ? ? ? ? 2.037 ? ? disulf3 disulf ? ? A CYS 34 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 52 A CYS 69 1_555 ? ? ? ? ? ? ? 2.035 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 26 ? CYS A 29 ? ARG A 44 CYS A 47 A 2 CYS A 34 ? TYR A 37 ? CYS A 52 TYR A 55 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 26 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 44 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 37 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 55 # _atom_sites.entry_id 2LFL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 19 19 GLY GLY A . n A 1 2 ASP 2 20 20 ASP ASP A . n A 1 3 LYS 3 21 21 LYS LYS A . n A 1 4 GLU 4 22 22 GLU GLU A . n A 1 5 GLU 5 23 23 GLU GLU A . n A 1 6 CYS 6 24 24 CYS CYS A . n A 1 7 THR 7 25 25 THR THR A . n A 1 8 VAL 8 26 26 VAL VAL A . n A 1 9 PRO 9 27 27 PRO PRO A . n A 1 10 ILE 10 28 28 ILE ILE A . n A 1 11 GLY 11 29 29 GLY GLY A . n A 1 12 TRP 12 30 30 TRP TRP A . n A 1 13 SER 13 31 31 SER SER A . n A 1 14 GLU 14 32 32 GLU GLU A . n A 1 15 PRO 15 33 33 PRO PRO A . n A 1 16 VAL 16 34 34 VAL VAL A . n A 1 17 LYS 17 35 35 LYS LYS A . n A 1 18 GLY 18 36 36 GLY GLY A . n A 1 19 LEU 19 37 37 LEU LEU A . n A 1 20 CYS 20 38 38 CYS CYS A . n A 1 21 LYS 21 39 39 LYS LYS A . n A 1 22 ALA 22 40 40 ALA ALA A . n A 1 23 ARG 23 41 41 ARG ARG A . n A 1 24 PHE 24 42 42 PHE PHE A . n A 1 25 THR 25 43 43 THR THR A . n A 1 26 ARG 26 44 44 ARG ARG A . n A 1 27 TYR 27 45 45 TYR TYR A . n A 1 28 TYR 28 46 46 TYR TYR A . n A 1 29 CYS 29 47 47 CYS CYS A . n A 1 30 MET 30 48 48 MET MET A . n A 1 31 GLY 31 49 49 GLY GLY A . n A 1 32 ASN 32 50 50 ASN ASN A . n A 1 33 CYS 33 51 51 CYS CYS A . n A 1 34 CYS 34 52 52 CYS CYS A . n A 1 35 LYS 35 53 53 LYS LYS A . n A 1 36 VAL 36 54 54 VAL VAL A . n A 1 37 TYR 37 55 55 TYR TYR A . n A 1 38 GLU 38 56 56 GLU GLU A . n A 1 39 GLY 39 57 57 GLY GLY A . n A 1 40 CYS 40 58 58 CYS CYS A . n A 1 41 TYR 41 59 59 TYR TYR A . n A 1 42 THR 42 60 60 THR THR A . n A 1 43 GLY 43 61 61 GLY GLY A . n A 1 44 GLY 44 62 62 GLY GLY A . n A 1 45 TYR 45 63 63 TYR TYR A . n A 1 46 SER 46 64 64 SER SER A . n A 1 47 ARG 47 65 65 ARG ARG A . n A 1 48 MET 48 66 66 MET MET A . n A 1 49 GLY 49 67 67 GLY GLY A . n A 1 50 GLU 50 68 68 GLU GLU A . n A 1 51 CYS 51 69 69 CYS CYS A . n A 1 52 ALA 52 70 70 ALA ALA A . n A 1 53 ARG 53 71 71 ARG ARG A . n A 1 54 ASN 54 72 72 ASN ASN A . n A 1 55 CYS 55 73 73 CYS CYS A . n A 1 56 PRO 56 74 74 PRO PRO A . n A 1 57 GLY 57 75 75 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-11-09 2 'Structure model' 1 1 2011-12-28 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_exptl_sample.component TdPI-short-1 _pdbx_nmr_exptl_sample.concentration 1.0 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LFL _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 597 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 404 _pdbx_nmr_constraints.NOE_long_range_total_count 9 _pdbx_nmr_constraints.NOE_medium_range_total_count 110 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 83 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 CA A CYS 52 ? ? CB A CYS 52 ? ? SG A CYS 52 ? ? 121.07 114.20 6.87 1.10 N 2 11 CA A CYS 52 ? ? CB A CYS 52 ? ? SG A CYS 52 ? ? 120.87 114.20 6.67 1.10 N 3 20 CA A CYS 52 ? ? CB A CYS 52 ? ? SG A CYS 52 ? ? 121.60 114.20 7.40 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 37 ? ? -150.93 79.59 2 1 MET A 48 ? ? -84.97 -90.68 3 1 ASN A 50 ? ? -131.43 -49.20 4 2 CYS A 24 ? ? -96.70 58.41 5 2 SER A 31 ? ? -135.31 -79.24 6 2 THR A 60 ? ? -142.71 -19.17 7 3 CYS A 24 ? ? -120.81 -78.77 8 3 LEU A 37 ? ? -76.26 47.49 9 3 LYS A 39 ? ? -145.23 16.54 10 4 MET A 48 ? ? -93.47 -91.00 11 4 ASN A 50 ? ? -146.02 -58.43 12 4 TYR A 59 ? ? -138.18 -40.63 13 4 THR A 60 ? ? -144.89 -22.40 14 4 SER A 64 ? ? 55.53 -3.40 15 5 CYS A 58 ? ? -68.01 14.41 16 5 TYR A 59 ? ? -60.48 99.97 17 5 SER A 64 ? ? 58.63 4.48 18 6 LYS A 35 ? ? 55.27 2.75 19 6 ASN A 50 ? ? 58.92 11.43 20 6 SER A 64 ? ? 55.38 -4.28 21 7 MET A 48 ? ? -132.79 -80.37 22 7 ASN A 50 ? ? 59.68 14.04 23 7 SER A 64 ? ? 60.47 -14.07 24 8 LYS A 39 ? ? -127.84 -60.00 25 8 ASN A 50 ? ? -145.94 -52.22 26 8 SER A 64 ? ? 59.95 5.50 27 9 ASN A 50 ? ? -141.82 -53.98 28 9 TYR A 59 ? ? -68.36 97.46 29 10 LEU A 37 ? ? -78.96 32.55 30 10 CYS A 38 ? ? -66.17 12.83 31 10 ASN A 50 ? ? -123.63 -53.81 32 12 LYS A 21 ? ? 55.65 18.03 33 12 CYS A 24 ? ? -68.28 75.77 34 12 LYS A 39 ? ? 60.13 -0.91 35 12 THR A 60 ? ? 54.29 -0.65 36 13 ASN A 50 ? ? -133.97 -59.76 37 14 LYS A 39 ? ? -142.43 24.90 38 14 THR A 60 ? ? -155.28 82.65 39 15 LYS A 39 ? ? -79.60 37.87 40 15 ASN A 50 ? ? 63.24 -11.00 41 15 THR A 60 ? ? 49.43 14.67 42 16 LYS A 21 ? ? 49.30 29.78 43 16 ASN A 50 ? ? -133.32 -53.83 44 17 LYS A 35 ? ? -145.71 -28.57 45 17 CYS A 58 ? ? -80.33 39.08 46 17 THR A 60 ? ? -144.05 -23.86 47 18 CYS A 38 ? ? -68.30 77.39 48 18 THR A 60 ? ? -136.89 -44.68 49 19 THR A 25 ? ? -16.20 -72.93 50 19 ASN A 50 ? ? -136.55 -62.68 51 20 LYS A 39 ? ? -118.05 70.87 52 20 ASN A 50 ? ? 66.31 -2.67 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 7 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 46 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.066 _pdbx_validate_planes.type 'SIDE CHAIN' #