data_2LG6 # _entry.id 2LG6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LG6 pdb_00002lg6 10.2210/pdb2lg6/pdb RCSB RCSB102352 ? ? BMRB 17798 ? 10.13018/BMR17798 WWPDB D_1000102352 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-04-25 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' struct_ref_seq_dif 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 7 3 'Structure model' pdbx_entry_details 8 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_struct_ref_seq_dif.details' 5 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LG6 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-07-21 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17798 BMRB unspecified . 2LG5 PDB unspecified 'wild type protein' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Meudal, H.' 1 'Landon, C.' 2 # _citation.id primary _citation.title 'Initial insights into structure-activity relationships of avian defensins.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 287 _citation.page_first 7746 _citation.page_last 7755 _citation.year 2012 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22205704 _citation.pdbx_database_id_DOI 10.1074/jbc.M111.312108 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Derache, C.' 1 ? primary 'Meudal, H.' 2 ? primary 'Aucagne, V.' 3 ? primary 'Mark, K.J.' 4 ? primary 'Cadene, M.' 5 ? primary 'Delmas, A.F.' 6 ? primary 'Lalmanach, A.C.' 7 ? primary 'Landon, C.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description Gallinacin-2 _entity.formula_weight 3869.548 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation K31A _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Gal-2, Beta-defensin 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LFCKGGSCHFGGCPSHLIKVGSCFGFRSCCAWPWNA _entity_poly.pdbx_seq_one_letter_code_can LFCKGGSCHFGGCPSHLIKVGSCFGFRSCCAWPWNA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 PHE n 1 3 CYS n 1 4 LYS n 1 5 GLY n 1 6 GLY n 1 7 SER n 1 8 CYS n 1 9 HIS n 1 10 PHE n 1 11 GLY n 1 12 GLY n 1 13 CYS n 1 14 PRO n 1 15 SER n 1 16 HIS n 1 17 LEU n 1 18 ILE n 1 19 LYS n 1 20 VAL n 1 21 GLY n 1 22 SER n 1 23 CYS n 1 24 PHE n 1 25 GLY n 1 26 PHE n 1 27 ARG n 1 28 SER n 1 29 CYS n 1 30 CYS n 1 31 ALA n 1 32 TRP n 1 33 PRO n 1 34 TRP n 1 35 ASN n 1 36 ALA n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Gallus gallus' _pdbx_entity_src_syn.organism_common_name bantam,chickens _pdbx_entity_src_syn.ncbi_taxonomy_id 9031 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ALA 36 36 36 ALA ALA A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LG6 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LG6 _struct.title 'NMR structure of chicken AvBD2-K31A mutant' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LG6 _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' _struct_keywords.text 'ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLL2_CHICK _struct_ref.pdbx_db_accession P46158 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LFCKGGSCHFGGCPSHLIKVGSCFGFRSCCKWPWNA _struct_ref.pdbx_align_begin 29 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LG6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P46158 _struct_ref_seq.db_align_beg 29 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 64 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 36 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2LG6 _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 31 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P46158 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 59 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 31 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id TRP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 32 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 36 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id TRP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 32 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 36 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 3 A CYS 29 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 23 SG ? ? A CYS 8 A CYS 23 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf3 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 13 A CYS 30 1_555 ? ? ? ? ? ? ? 2.022 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 3 ? CYS A 29 ? CYS A 3 ? 1_555 CYS A 29 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 8 ? CYS A 23 ? CYS A 8 ? 1_555 CYS A 23 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 13 ? CYS A 30 ? CYS A 13 ? 1_555 CYS A 30 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 2 ? CYS A 3 ? PHE A 2 CYS A 3 A 2 GLY A 6 ? PHE A 10 ? GLY A 6 PHE A 10 A 3 ARG A 27 ? ALA A 31 ? ARG A 27 ALA A 31 A 4 ILE A 18 ? SER A 22 ? ILE A 18 SER A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 3 ? N CYS A 3 O GLY A 6 ? O GLY A 6 A 2 3 N HIS A 9 ? N HIS A 9 O SER A 28 ? O SER A 28 A 3 4 O ALA A 31 ? O ALA A 31 N ILE A 18 ? N ILE A 18 # _pdbx_entry_details.entry_id 2LG6 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 4 ? ? -42.82 80.31 2 1 SER A 15 ? ? -36.56 -36.29 3 1 TRP A 34 ? ? -29.79 -33.41 4 1 ASN A 35 ? ? -157.62 40.82 5 2 LYS A 4 ? ? -43.24 79.78 6 2 SER A 15 ? ? -36.22 -33.26 7 2 PHE A 26 ? ? -178.90 -16.65 8 2 TRP A 34 ? ? -29.38 -34.73 9 2 ASN A 35 ? ? -156.58 38.67 10 3 LYS A 4 ? ? -35.02 81.48 11 3 SER A 15 ? ? -36.02 -33.02 12 3 CYS A 23 ? ? -101.25 -165.21 13 3 PHE A 24 ? ? -57.55 107.65 14 3 TRP A 34 ? ? -27.27 -36.04 15 3 ASN A 35 ? ? -159.28 29.35 16 4 LYS A 4 ? ? -45.58 81.58 17 4 SER A 15 ? ? -36.11 -33.88 18 4 LYS A 19 ? ? -64.87 95.29 19 4 PHE A 24 ? ? -53.27 105.20 20 4 TRP A 34 ? ? -21.90 -37.46 21 4 ASN A 35 ? ? -155.04 20.58 22 5 LYS A 4 ? ? -40.66 80.58 23 5 SER A 15 ? ? -35.61 -33.59 24 5 PHE A 26 ? ? 179.08 -10.97 25 5 TRP A 34 ? ? -26.40 -35.64 26 5 ASN A 35 ? ? -158.59 20.59 27 6 LYS A 4 ? ? -40.91 83.29 28 6 SER A 15 ? ? -34.76 -32.67 29 6 LYS A 19 ? ? -69.97 97.09 30 6 PHE A 26 ? ? -180.00 -5.56 31 6 TRP A 34 ? ? -23.14 -38.16 32 6 ASN A 35 ? ? -158.54 40.75 33 7 LYS A 4 ? ? -34.02 78.74 34 7 SER A 15 ? ? -35.91 -34.19 35 7 LYS A 19 ? ? -68.71 93.47 36 7 CYS A 23 ? ? -123.87 -164.86 37 7 PHE A 26 ? ? 179.45 -13.11 38 7 TRP A 34 ? ? -26.16 -35.91 39 7 ASN A 35 ? ? -155.28 31.83 40 8 LYS A 4 ? ? -48.67 79.33 41 8 SER A 15 ? ? -36.16 -26.82 42 8 PHE A 24 ? ? -52.89 109.24 43 8 TRP A 34 ? ? -26.16 -34.91 44 8 ASN A 35 ? ? -158.23 37.76 45 9 LYS A 4 ? ? -41.86 80.34 46 9 SER A 15 ? ? -36.30 -32.28 47 9 PHE A 26 ? ? -179.29 -6.58 48 9 TRP A 34 ? ? -28.84 -34.23 49 9 ASN A 35 ? ? -157.52 35.61 50 10 LYS A 4 ? ? -41.79 81.09 51 10 SER A 15 ? ? -36.97 -26.71 52 10 CYS A 23 ? ? -121.54 -164.49 53 10 PHE A 26 ? ? 179.54 -12.35 54 10 TRP A 34 ? ? -27.92 -36.58 55 10 ASN A 35 ? ? -159.09 29.38 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LG6 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LG6 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '2.4 mM chicken AvBD2-K31A mutant, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '2.4 mM chicken AvBD2-K31A mutant, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'chicken AvBD2-K31A mutant-1' 2.4 ? mM ? 1 'chicken AvBD2-K31A mutant-2' 2.4 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 4.1 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H COSY' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-1H NOESY' 1 4 2 '2D 1H-1H COSY' 1 5 2 '2D 1H-1H TOCSY' 1 6 2 '2D 1H-1H NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LG6 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1069 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 296 _pdbx_nmr_constraints.NOE_long_range_total_count 342 _pdbx_nmr_constraints.NOE_medium_range_total_count 170 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 261 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2LG6 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 2 'Johnson, One Moon Scientific' 'peak picking' NMRView ? 3 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 1.1 4 ;Linge, O'Donoghue and Nilges ; refinement ARIA 1.1 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLY N N N N 72 GLY CA C N N 73 GLY C C N N 74 GLY O O N N 75 GLY OXT O N N 76 GLY H H N N 77 GLY H2 H N N 78 GLY HA2 H N N 79 GLY HA3 H N N 80 GLY HXT H N N 81 HIS N N N N 82 HIS CA C N S 83 HIS C C N N 84 HIS O O N N 85 HIS CB C N N 86 HIS CG C Y N 87 HIS ND1 N Y N 88 HIS CD2 C Y N 89 HIS CE1 C Y N 90 HIS NE2 N Y N 91 HIS OXT O N N 92 HIS H H N N 93 HIS H2 H N N 94 HIS HA H N N 95 HIS HB2 H N N 96 HIS HB3 H N N 97 HIS HD1 H N N 98 HIS HD2 H N N 99 HIS HE1 H N N 100 HIS HE2 H N N 101 HIS HXT H N N 102 ILE N N N N 103 ILE CA C N S 104 ILE C C N N 105 ILE O O N N 106 ILE CB C N S 107 ILE CG1 C N N 108 ILE CG2 C N N 109 ILE CD1 C N N 110 ILE OXT O N N 111 ILE H H N N 112 ILE H2 H N N 113 ILE HA H N N 114 ILE HB H N N 115 ILE HG12 H N N 116 ILE HG13 H N N 117 ILE HG21 H N N 118 ILE HG22 H N N 119 ILE HG23 H N N 120 ILE HD11 H N N 121 ILE HD12 H N N 122 ILE HD13 H N N 123 ILE HXT H N N 124 LEU N N N N 125 LEU CA C N S 126 LEU C C N N 127 LEU O O N N 128 LEU CB C N N 129 LEU CG C N N 130 LEU CD1 C N N 131 LEU CD2 C N N 132 LEU OXT O N N 133 LEU H H N N 134 LEU H2 H N N 135 LEU HA H N N 136 LEU HB2 H N N 137 LEU HB3 H N N 138 LEU HG H N N 139 LEU HD11 H N N 140 LEU HD12 H N N 141 LEU HD13 H N N 142 LEU HD21 H N N 143 LEU HD22 H N N 144 LEU HD23 H N N 145 LEU HXT H N N 146 LYS N N N N 147 LYS CA C N S 148 LYS C C N N 149 LYS O O N N 150 LYS CB C N N 151 LYS CG C N N 152 LYS CD C N N 153 LYS CE C N N 154 LYS NZ N N N 155 LYS OXT O N N 156 LYS H H N N 157 LYS H2 H N N 158 LYS HA H N N 159 LYS HB2 H N N 160 LYS HB3 H N N 161 LYS HG2 H N N 162 LYS HG3 H N N 163 LYS HD2 H N N 164 LYS HD3 H N N 165 LYS HE2 H N N 166 LYS HE3 H N N 167 LYS HZ1 H N N 168 LYS HZ2 H N N 169 LYS HZ3 H N N 170 LYS HXT H N N 171 PHE N N N N 172 PHE CA C N S 173 PHE C C N N 174 PHE O O N N 175 PHE CB C N N 176 PHE CG C Y N 177 PHE CD1 C Y N 178 PHE CD2 C Y N 179 PHE CE1 C Y N 180 PHE CE2 C Y N 181 PHE CZ C Y N 182 PHE OXT O N N 183 PHE H H N N 184 PHE H2 H N N 185 PHE HA H N N 186 PHE HB2 H N N 187 PHE HB3 H N N 188 PHE HD1 H N N 189 PHE HD2 H N N 190 PHE HE1 H N N 191 PHE HE2 H N N 192 PHE HZ H N N 193 PHE HXT H N N 194 PRO N N N N 195 PRO CA C N S 196 PRO C C N N 197 PRO O O N N 198 PRO CB C N N 199 PRO CG C N N 200 PRO CD C N N 201 PRO OXT O N N 202 PRO H H N N 203 PRO HA H N N 204 PRO HB2 H N N 205 PRO HB3 H N N 206 PRO HG2 H N N 207 PRO HG3 H N N 208 PRO HD2 H N N 209 PRO HD3 H N N 210 PRO HXT H N N 211 SER N N N N 212 SER CA C N S 213 SER C C N N 214 SER O O N N 215 SER CB C N N 216 SER OG O N N 217 SER OXT O N N 218 SER H H N N 219 SER H2 H N N 220 SER HA H N N 221 SER HB2 H N N 222 SER HB3 H N N 223 SER HG H N N 224 SER HXT H N N 225 TRP N N N N 226 TRP CA C N S 227 TRP C C N N 228 TRP O O N N 229 TRP CB C N N 230 TRP CG C Y N 231 TRP CD1 C Y N 232 TRP CD2 C Y N 233 TRP NE1 N Y N 234 TRP CE2 C Y N 235 TRP CE3 C Y N 236 TRP CZ2 C Y N 237 TRP CZ3 C Y N 238 TRP CH2 C Y N 239 TRP OXT O N N 240 TRP H H N N 241 TRP H2 H N N 242 TRP HA H N N 243 TRP HB2 H N N 244 TRP HB3 H N N 245 TRP HD1 H N N 246 TRP HE1 H N N 247 TRP HE3 H N N 248 TRP HZ2 H N N 249 TRP HZ3 H N N 250 TRP HH2 H N N 251 TRP HXT H N N 252 VAL N N N N 253 VAL CA C N S 254 VAL C C N N 255 VAL O O N N 256 VAL CB C N N 257 VAL CG1 C N N 258 VAL CG2 C N N 259 VAL OXT O N N 260 VAL H H N N 261 VAL H2 H N N 262 VAL HA H N N 263 VAL HB H N N 264 VAL HG11 H N N 265 VAL HG12 H N N 266 VAL HG13 H N N 267 VAL HG21 H N N 268 VAL HG22 H N N 269 VAL HG23 H N N 270 VAL HXT H N N 271 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLY N CA sing N N 68 GLY N H sing N N 69 GLY N H2 sing N N 70 GLY CA C sing N N 71 GLY CA HA2 sing N N 72 GLY CA HA3 sing N N 73 GLY C O doub N N 74 GLY C OXT sing N N 75 GLY OXT HXT sing N N 76 HIS N CA sing N N 77 HIS N H sing N N 78 HIS N H2 sing N N 79 HIS CA C sing N N 80 HIS CA CB sing N N 81 HIS CA HA sing N N 82 HIS C O doub N N 83 HIS C OXT sing N N 84 HIS CB CG sing N N 85 HIS CB HB2 sing N N 86 HIS CB HB3 sing N N 87 HIS CG ND1 sing Y N 88 HIS CG CD2 doub Y N 89 HIS ND1 CE1 doub Y N 90 HIS ND1 HD1 sing N N 91 HIS CD2 NE2 sing Y N 92 HIS CD2 HD2 sing N N 93 HIS CE1 NE2 sing Y N 94 HIS CE1 HE1 sing N N 95 HIS NE2 HE2 sing N N 96 HIS OXT HXT sing N N 97 ILE N CA sing N N 98 ILE N H sing N N 99 ILE N H2 sing N N 100 ILE CA C sing N N 101 ILE CA CB sing N N 102 ILE CA HA sing N N 103 ILE C O doub N N 104 ILE C OXT sing N N 105 ILE CB CG1 sing N N 106 ILE CB CG2 sing N N 107 ILE CB HB sing N N 108 ILE CG1 CD1 sing N N 109 ILE CG1 HG12 sing N N 110 ILE CG1 HG13 sing N N 111 ILE CG2 HG21 sing N N 112 ILE CG2 HG22 sing N N 113 ILE CG2 HG23 sing N N 114 ILE CD1 HD11 sing N N 115 ILE CD1 HD12 sing N N 116 ILE CD1 HD13 sing N N 117 ILE OXT HXT sing N N 118 LEU N CA sing N N 119 LEU N H sing N N 120 LEU N H2 sing N N 121 LEU CA C sing N N 122 LEU CA CB sing N N 123 LEU CA HA sing N N 124 LEU C O doub N N 125 LEU C OXT sing N N 126 LEU CB CG sing N N 127 LEU CB HB2 sing N N 128 LEU CB HB3 sing N N 129 LEU CG CD1 sing N N 130 LEU CG CD2 sing N N 131 LEU CG HG sing N N 132 LEU CD1 HD11 sing N N 133 LEU CD1 HD12 sing N N 134 LEU CD1 HD13 sing N N 135 LEU CD2 HD21 sing N N 136 LEU CD2 HD22 sing N N 137 LEU CD2 HD23 sing N N 138 LEU OXT HXT sing N N 139 LYS N CA sing N N 140 LYS N H sing N N 141 LYS N H2 sing N N 142 LYS CA C sing N N 143 LYS CA CB sing N N 144 LYS CA HA sing N N 145 LYS C O doub N N 146 LYS C OXT sing N N 147 LYS CB CG sing N N 148 LYS CB HB2 sing N N 149 LYS CB HB3 sing N N 150 LYS CG CD sing N N 151 LYS CG HG2 sing N N 152 LYS CG HG3 sing N N 153 LYS CD CE sing N N 154 LYS CD HD2 sing N N 155 LYS CD HD3 sing N N 156 LYS CE NZ sing N N 157 LYS CE HE2 sing N N 158 LYS CE HE3 sing N N 159 LYS NZ HZ1 sing N N 160 LYS NZ HZ2 sing N N 161 LYS NZ HZ3 sing N N 162 LYS OXT HXT sing N N 163 PHE N CA sing N N 164 PHE N H sing N N 165 PHE N H2 sing N N 166 PHE CA C sing N N 167 PHE CA CB sing N N 168 PHE CA HA sing N N 169 PHE C O doub N N 170 PHE C OXT sing N N 171 PHE CB CG sing N N 172 PHE CB HB2 sing N N 173 PHE CB HB3 sing N N 174 PHE CG CD1 doub Y N 175 PHE CG CD2 sing Y N 176 PHE CD1 CE1 sing Y N 177 PHE CD1 HD1 sing N N 178 PHE CD2 CE2 doub Y N 179 PHE CD2 HD2 sing N N 180 PHE CE1 CZ doub Y N 181 PHE CE1 HE1 sing N N 182 PHE CE2 CZ sing Y N 183 PHE CE2 HE2 sing N N 184 PHE CZ HZ sing N N 185 PHE OXT HXT sing N N 186 PRO N CA sing N N 187 PRO N CD sing N N 188 PRO N H sing N N 189 PRO CA C sing N N 190 PRO CA CB sing N N 191 PRO CA HA sing N N 192 PRO C O doub N N 193 PRO C OXT sing N N 194 PRO CB CG sing N N 195 PRO CB HB2 sing N N 196 PRO CB HB3 sing N N 197 PRO CG CD sing N N 198 PRO CG HG2 sing N N 199 PRO CG HG3 sing N N 200 PRO CD HD2 sing N N 201 PRO CD HD3 sing N N 202 PRO OXT HXT sing N N 203 SER N CA sing N N 204 SER N H sing N N 205 SER N H2 sing N N 206 SER CA C sing N N 207 SER CA CB sing N N 208 SER CA HA sing N N 209 SER C O doub N N 210 SER C OXT sing N N 211 SER CB OG sing N N 212 SER CB HB2 sing N N 213 SER CB HB3 sing N N 214 SER OG HG sing N N 215 SER OXT HXT sing N N 216 TRP N CA sing N N 217 TRP N H sing N N 218 TRP N H2 sing N N 219 TRP CA C sing N N 220 TRP CA CB sing N N 221 TRP CA HA sing N N 222 TRP C O doub N N 223 TRP C OXT sing N N 224 TRP CB CG sing N N 225 TRP CB HB2 sing N N 226 TRP CB HB3 sing N N 227 TRP CG CD1 doub Y N 228 TRP CG CD2 sing Y N 229 TRP CD1 NE1 sing Y N 230 TRP CD1 HD1 sing N N 231 TRP CD2 CE2 doub Y N 232 TRP CD2 CE3 sing Y N 233 TRP NE1 CE2 sing Y N 234 TRP NE1 HE1 sing N N 235 TRP CE2 CZ2 sing Y N 236 TRP CE3 CZ3 doub Y N 237 TRP CE3 HE3 sing N N 238 TRP CZ2 CH2 doub Y N 239 TRP CZ2 HZ2 sing N N 240 TRP CZ3 CH2 sing Y N 241 TRP CZ3 HZ3 sing N N 242 TRP CH2 HH2 sing N N 243 TRP OXT HXT sing N N 244 VAL N CA sing N N 245 VAL N H sing N N 246 VAL N H2 sing N N 247 VAL CA C sing N N 248 VAL CA CB sing N N 249 VAL CA HA sing N N 250 VAL C O doub N N 251 VAL C OXT sing N N 252 VAL CB CG1 sing N N 253 VAL CB CG2 sing N N 254 VAL CB HB sing N N 255 VAL CG1 HG11 sing N N 256 VAL CG1 HG12 sing N N 257 VAL CG1 HG13 sing N N 258 VAL CG2 HG21 sing N N 259 VAL CG2 HG22 sing N N 260 VAL CG2 HG23 sing N N 261 VAL OXT HXT sing N N 262 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _atom_sites.entry_id 2LG6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #