data_2LGB # _entry.id 2LGB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LGB pdb_00002lgb 10.2210/pdb2lgb/pdb RCSB RCSB102357 ? ? BMRB 17803 ? ? WWPDB D_1000102357 ? ? # _pdbx_database_related.db_id 17803 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LGB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-07-25 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bocian, W.' 1 'Kozerski, L.' 2 # _citation.id primary _citation.title 'Recombinant A22(G)-B31 (R)-human insulin. A22 addition introduces conformational mobility in B chain C-terminus.' _citation.journal_abbrev J.Biomol.Nmr _citation.journal_volume 52 _citation.page_first 365 _citation.page_last 370 _citation.year 2012 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22350952 _citation.pdbx_database_id_DOI 10.1007/s10858-012-9612-y # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Borowicz, P.' 1 ? primary 'Bednarek, E.' 2 ? primary 'Bocian, W.' 3 ? primary 'Sitkowski, J.' 4 ? primary 'Jaworska, B.' 5 ? primary 'Mikolajczyk, J.' 6 ? primary 'Glabski, T.' 7 ? primary 'Stadnik, D.' 8 ? primary 'Surmacz, W.' 9 ? primary 'Bogiel, M.' 10 ? primary 'Kozerski, L.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Insulin A chain' 2440.750 1 ? ? ? ? 2 polymer man 'Insulin B chain' 3591.146 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCNG GIVEQCCTSICSLYQLENYCNG A ? 2 'polypeptide(L)' no no FVNQHLCGSHLVEALYLVCGERGFFYTPKTR FVNQHLCGSHLVEALYLVCGERGFFYTPKTR B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 VAL n 1 4 GLU n 1 5 GLN n 1 6 CYS n 1 7 CYS n 1 8 THR n 1 9 SER n 1 10 ILE n 1 11 CYS n 1 12 SER n 1 13 LEU n 1 14 TYR n 1 15 GLN n 1 16 LEU n 1 17 GLU n 1 18 ASN n 1 19 TYR n 1 20 CYS n 1 21 ASN n 1 22 GLY n 2 1 PHE n 2 2 VAL n 2 3 ASN n 2 4 GLN n 2 5 HIS n 2 6 LEU n 2 7 CYS n 2 8 GLY n 2 9 SER n 2 10 HIS n 2 11 LEU n 2 12 VAL n 2 13 GLU n 2 14 ALA n 2 15 LEU n 2 16 TYR n 2 17 LEU n 2 18 VAL n 2 19 CYS n 2 20 GLY n 2 21 GLU n 2 22 ARG n 2 23 GLY n 2 24 PHE n 2 25 PHE n 2 26 TYR n 2 27 THR n 2 28 PRO n 2 29 LYS n 2 30 THR n 2 31 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? human ? INS ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'PDBAST RAT-N-7-1' ? ? ? ? ? 2 1 sample ? ? ? human ? INS ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'PDBAST RAT-N-7-1' ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP INS_HUMAN P01308 1 GIVEQCCTSICSLYQLENYCN 90 ? 2 UNP INS_HUMAN P01308 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKTR 25 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LGB A 1 ? 21 ? P01308 90 ? 110 ? 1 21 2 2 2LGB B 1 ? 31 ? P01308 25 ? 55 ? 101 131 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2LGB _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 22 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P01308 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details insertion _struct_ref_seq_dif.pdbx_auth_seq_num 22 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D 1H-1H NOESY' 1 3 2 '2D 1H-1H NOESY' 1 4 2 '2D 1H-13C HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 3.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '3.0 - 2.0 mM Insulin A chain, 3.0 - 2.0 mM Insulin B chain, 65% H2O / 35% CD3CN' 1 '65% H2O / 35% CD3CN' '3.0 - 2.0 mM Insulin A chain, 3.0 - 2.0 mM Insulin B chain, 65% D2O / 35% CD3CN' 2 '65% D2O / 35% CD3CN' # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model 'Uniform NMR System' _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian Uniform NMR System' # _pdbx_nmr_refine.entry_id 2LGB _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy and with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LGB _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LGB _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, and Kollm' refinement Amber 9 1 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, and Kollm' 'geometry optimization' Amber 9 2 Varian collection VnmrJ 2.2C 3 Goddard 'chemical shift assignment' Sparky 2.6 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LGB _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LGB _struct.title 'Modified A22Gly-B31Arg Human Insulin' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LGB _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text Hormone # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 3 ? THR A 8 ? VAL A 3 THR A 8 1 ? 6 HELX_P HELX_P2 2 SER A 12 ? GLY A 22 ? SER A 12 GLY A 22 1 ? 11 HELX_P HELX_P3 3 CYS B 7 ? CYS B 19 ? CYS B 107 CYS B 119 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6 A CYS 11 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 B CYS 7 SG ? ? A CYS 7 B CYS 107 1_555 ? ? ? ? ? ? ? 2.043 ? ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 119 1_555 ? ? ? ? ? ? ? 2.038 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 2LGB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 GLY 22 22 22 GLY GLY A . n B 2 1 PHE 1 101 101 PHE PHE B . n B 2 2 VAL 2 102 102 VAL VAL B . n B 2 3 ASN 3 103 103 ASN ASN B . n B 2 4 GLN 4 104 104 GLN GLN B . n B 2 5 HIS 5 105 105 HIS HIS B . n B 2 6 LEU 6 106 106 LEU LEU B . n B 2 7 CYS 7 107 107 CYS CYS B . n B 2 8 GLY 8 108 108 GLY GLY B . n B 2 9 SER 9 109 109 SER SER B . n B 2 10 HIS 10 110 110 HIS HIS B . n B 2 11 LEU 11 111 111 LEU LEU B . n B 2 12 VAL 12 112 112 VAL VAL B . n B 2 13 GLU 13 113 113 GLU GLU B . n B 2 14 ALA 14 114 114 ALA ALA B . n B 2 15 LEU 15 115 115 LEU LEU B . n B 2 16 TYR 16 116 116 TYR TYR B . n B 2 17 LEU 17 117 117 LEU LEU B . n B 2 18 VAL 18 118 118 VAL VAL B . n B 2 19 CYS 19 119 119 CYS CYS B . n B 2 20 GLY 20 120 120 GLY GLY B . n B 2 21 GLU 21 121 121 GLU GLU B . n B 2 22 ARG 22 122 122 ARG ARG B . n B 2 23 GLY 23 123 123 GLY GLY B . n B 2 24 PHE 24 124 124 PHE PHE B . n B 2 25 PHE 25 125 125 PHE PHE B . n B 2 26 TYR 26 126 126 TYR TYR B . n B 2 27 THR 27 127 127 THR THR B . n B 2 28 PRO 28 128 128 PRO PRO B . n B 2 29 LYS 29 129 129 LYS LYS B . n B 2 30 THR 30 130 130 THR THR B . n B 2 31 ARG 31 131 131 ARG ARG B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-04-11 2 'Structure model' 1 1 2012-07-04 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein_1-1 ? 3.0-2.0 mM ? 1 protein_2-2 ? 3.0-2.0 mM ? 1 protein_1-3 ? 3.0-2.0 mM ? 2 protein_2-4 ? 3.0-2.0 mM ? 2 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 3 NE B ARG 122 ? ? CZ B ARG 122 ? ? NH1 B ARG 122 ? ? 123.63 120.30 3.33 0.50 N 2 6 NE B ARG 122 ? ? CZ B ARG 122 ? ? NH1 B ARG 122 ? ? 124.44 120.30 4.14 0.50 N 3 11 NE B ARG 122 ? ? CZ B ARG 122 ? ? NH1 B ARG 122 ? ? 123.88 120.30 3.58 0.50 N 4 14 NE B ARG 122 ? ? CZ B ARG 122 ? ? NH1 B ARG 122 ? ? 123.92 120.30 3.62 0.50 N 5 17 NE B ARG 122 ? ? CZ B ARG 122 ? ? NH1 B ARG 122 ? ? 124.05 120.30 3.75 0.50 N 6 18 NE B ARG 122 ? ? CZ B ARG 122 ? ? NH1 B ARG 122 ? ? 124.09 120.30 3.79 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG B 122 ? ? -85.34 -76.63 2 2 ILE A 2 ? ? -143.57 -60.42 3 2 GLN A 5 ? ? -125.86 -53.26 4 3 GLU A 4 ? ? -77.57 20.18 5 3 PHE B 124 ? ? -56.50 171.34 6 3 LYS B 129 ? ? 48.35 20.11 7 4 VAL B 102 ? ? 64.53 139.56 8 4 ASN B 103 ? ? 49.65 19.91 9 4 TYR B 126 ? ? 60.22 -28.62 10 5 ASN A 21 ? ? -81.08 43.20 11 5 TYR B 126 ? ? 68.81 157.72 12 6 GLU B 121 ? ? -67.80 3.02 13 6 PHE B 124 ? ? 42.60 -89.83 14 6 TYR B 126 ? ? 64.83 155.09 15 7 CYS A 20 ? ? -76.10 44.83 16 7 ASN B 103 ? ? -78.18 49.57 17 7 THR B 127 ? ? 41.87 73.42 18 8 GLU B 121 ? ? -73.46 35.30 19 8 PHE B 124 ? ? -131.29 -40.20 20 9 ASN A 21 ? ? -141.27 -39.36 21 9 ASN B 103 ? ? 53.57 179.84 22 9 GLN B 104 ? ? 61.94 -174.60 23 9 TYR B 126 ? ? 59.60 171.78 24 10 ILE A 2 ? ? -157.54 -50.33 25 10 VAL B 102 ? ? 65.19 135.75 26 11 ILE A 2 ? ? -156.70 -41.25 27 11 GLN B 104 ? ? 50.64 -177.94 28 12 PHE B 125 ? ? 61.29 133.04 29 13 PHE B 124 ? ? 45.06 -102.21 30 14 ILE A 2 ? ? -155.08 -47.56 31 14 VAL B 102 ? ? 53.74 -141.34 32 15 PHE B 125 ? ? 63.27 -52.28 33 17 ILE A 2 ? ? -132.77 -57.53 34 17 VAL B 102 ? ? 43.81 -135.14 35 18 ILE A 2 ? ? 64.10 -51.23 36 18 ASN B 103 ? ? -89.56 40.62 37 18 PHE B 125 ? ? 48.92 -120.06 38 19 ILE A 2 ? ? 55.71 -41.56 #