data_2LGK # _entry.id 2LGK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LGK pdb_00002lgk 10.2210/pdb2lgk/pdb RCSB RCSB102366 ? ? BMRB 17812 ? ? WWPDB D_1000102366 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17812 BMRB unspecified . 2LGG PDB unspecified . 2LGL PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LGK _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2011-07-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, C.' 1 'Shen, J.' 2 'Yang, Z.' 3 'Chen, P.' 4 'Zhao, B.' 5 'Hu, W.' 6 'Lan, W.' 7 'Tong, X.' 8 'Wu, H.' 9 'Li, G.' 10 'Cao, C.' 11 # _citation.id primary _citation.title 'Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.' _citation.journal_abbrev 'Cell Res.' _citation.journal_volume 21 _citation.page_first 1379 _citation.page_last 1382 _citation.year 2011 _citation.journal_id_ASTM ? _citation.country CN _citation.journal_id_ISSN 1001-0602 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21808299 _citation.pdbx_database_id_DOI 10.1038/cr.2011.123 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, C.' 1 ? primary 'Shen, J.' 2 ? primary 'Yang, Z.' 3 ? primary 'Chen, P.' 4 ? primary 'Zhao, B.' 5 ? primary 'Hu, W.' 6 ? primary 'Lan, W.' 7 ? primary 'Tong, X.' 8 ? primary 'Wu, H.' 9 ? primary 'Li, G.' 10 ? primary 'Cao, C.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase UHRF1' 7849.898 1 6.3.2.- ? 'UNP RESIDUES 298-366' ? 2 polymer syn 'histone H3 peptide' 1350.568 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Inverted CCAAT box-binding protein of 90 kDa, Nuclear protein 95, Nuclear zinc finger protein Np95, HuNp95, RING finger protein 106, Transcription factor ICBP90, Ubiquitin-like PHD and RING finger domain-containing protein 1, Ubiquitin-like-containing PHD and RING finger domains protein 1 ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND A ? 2 'polypeptide(L)' no yes 'ARTKQTAR(M3L)STG' ARTKQTARKSTG B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 PRO n 1 4 SER n 1 5 CYS n 1 6 LYS n 1 7 HIS n 1 8 CYS n 1 9 LYS n 1 10 ASP n 1 11 ASP n 1 12 VAL n 1 13 ASN n 1 14 ARG n 1 15 LEU n 1 16 CYS n 1 17 ARG n 1 18 VAL n 1 19 CYS n 1 20 ALA n 1 21 CYS n 1 22 HIS n 1 23 LEU n 1 24 CYS n 1 25 GLY n 1 26 GLY n 1 27 ARG n 1 28 GLN n 1 29 ASP n 1 30 PRO n 1 31 ASP n 1 32 LYS n 1 33 GLN n 1 34 LEU n 1 35 MET n 1 36 CYS n 1 37 ASP n 1 38 GLU n 1 39 CYS n 1 40 ASP n 1 41 MET n 1 42 ALA n 1 43 PHE n 1 44 HIS n 1 45 ILE n 1 46 TYR n 1 47 CYS n 1 48 LEU n 1 49 ASP n 1 50 PRO n 1 51 PRO n 1 52 LEU n 1 53 SER n 1 54 SER n 1 55 VAL n 1 56 PRO n 1 57 SER n 1 58 GLU n 1 59 ASP n 1 60 GLU n 1 61 TRP n 1 62 TYR n 1 63 CYS n 1 64 PRO n 1 65 GLU n 1 66 CYS n 1 67 ARG n 1 68 ASN n 1 69 ASP n 2 1 ALA n 2 2 ARG n 2 3 THR n 2 4 LYS n 2 5 GLN n 2 6 THR n 2 7 ALA n 2 8 ARG n 2 9 M3L n 2 10 SER n 2 11 THR n 2 12 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pETduet _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'The peptide was chemically synthesized.' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP UHRF1_HUMAN Q96T88 1 SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND 298 ? 2 PDB 2LGK 2LGK 2 ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LGK A 1 ? 69 ? Q96T88 298 ? 366 ? 311 379 2 2 2LGK B 1 ? 12 ? 2LGK 1 ? 12 ? 1 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 M3L 'L-peptide linking' n N-TRIMETHYLLYSINE ? 'C9 H21 N2 O2 1' 189.275 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 1 '3D HNCO' 1 5 1 '3D HNCA' 1 6 1 '3D HN(CO)CA' 1 7 1 '3D HNCACB' 1 8 1 '3D CBCA(CO)NH' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D HCCH-COSY' 1 11 1 '3D 1H-15N NOESY' 1 12 1 '3D 1H-13C NOESY aliphatic' 1 13 1 '3D 1H-13C NOESY aromatic' 1 14 1 '3D edited 15N/13C NOESY' 1 15 1 '2D 1H-1H COSY' 1 16 1 '2D 1H-1H NOESY' 1 17 1 '2D 1H-1H TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293.13 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.5 mM [U-100% 13C; U-100% 15N] entity_1-1, 1.8 mM entity_2-2, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LGK _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LGK _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LGK _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 1 2.19 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 2 2.19 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS 3 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 4 ? Goddard 'chemical shift assignment' Sparky 5 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LGK _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LGK _struct.title 'NMR Structure of UHRF1 PHD domains in a complex with histone H3 peptide' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LGK _struct_keywords.pdbx_keywords 'LIGASE/DNA BINDING PROTEIN' _struct_keywords.text 'UHRF1, PHD, Histone H3, LIGASE-DNA BINDING PROTEIN complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 29 ? GLN A 33 ? ASP A 339 GLN A 343 5 ? 5 HELX_P HELX_P2 2 CYS A 63 ? ASN A 68 ? CYS A 373 ASN A 378 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ARG 8 C ? ? ? 1_555 B M3L 9 N ? ? B ARG 8 B M3L 9 1_555 ? ? ? ? ? ? ? 1.304 ? ? covale2 covale both ? B M3L 9 C ? ? ? 1_555 B SER 10 N ? ? B M3L 9 B SER 10 1_555 ? ? ? ? ? ? ? 1.308 ? ? metalc1 metalc ? ? A CYS 5 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 315 A ZN 380 1_555 ? ? ? ? ? ? ? 2.298 ? ? metalc2 metalc ? ? A CYS 8 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 318 A ZN 380 1_555 ? ? ? ? ? ? ? 2.299 ? ? metalc3 metalc ? ? A CYS 16 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 326 A ZN 380 1_555 ? ? ? ? ? ? ? 2.300 ? ? metalc4 metalc ? ? A CYS 19 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 329 A ZN 380 1_555 ? ? ? ? ? ? ? 2.296 ? ? metalc5 metalc ? ? A CYS 21 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 331 A ZN 381 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc6 metalc ? ? A CYS 24 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 334 A ZN 381 1_555 ? ? ? ? ? ? ? 2.296 ? ? metalc7 metalc ? ? A CYS 36 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 346 A ZN 382 1_555 ? ? ? ? ? ? ? 2.309 ? ? metalc8 metalc ? ? A CYS 39 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 349 A ZN 382 1_555 ? ? ? ? ? ? ? 2.305 ? ? metalc9 metalc ? ? A HIS 44 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 354 A ZN 381 1_555 ? ? ? ? ? ? ? 2.003 ? ? metalc10 metalc ? ? A CYS 47 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 357 A ZN 381 1_555 ? ? ? ? ? ? ? 2.312 ? ? metalc11 metalc ? ? A CYS 63 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 373 A ZN 382 1_555 ? ? ? ? ? ? ? 2.306 ? ? metalc12 metalc ? ? A CYS 66 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 376 A ZN 382 1_555 ? ? ? ? ? ? ? 2.301 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 35 ? CYS A 36 ? MET A 345 CYS A 346 A 2 MET A 41 ? ALA A 42 ? MET A 351 ALA A 352 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id CYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 36 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 346 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id MET _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 41 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id MET _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 351 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 380 ? 4 'BINDING SITE FOR RESIDUE ZN A 380' AC2 Software A ZN 381 ? 4 'BINDING SITE FOR RESIDUE ZN A 381' AC3 Software A ZN 382 ? 4 'BINDING SITE FOR RESIDUE ZN A 382' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 5 ? CYS A 315 . ? 1_555 ? 2 AC1 4 CYS A 8 ? CYS A 318 . ? 1_555 ? 3 AC1 4 CYS A 16 ? CYS A 326 . ? 1_555 ? 4 AC1 4 CYS A 19 ? CYS A 329 . ? 1_555 ? 5 AC2 4 CYS A 21 ? CYS A 331 . ? 1_555 ? 6 AC2 4 CYS A 24 ? CYS A 334 . ? 1_555 ? 7 AC2 4 HIS A 44 ? HIS A 354 . ? 1_555 ? 8 AC2 4 CYS A 47 ? CYS A 357 . ? 1_555 ? 9 AC3 4 CYS A 36 ? CYS A 346 . ? 1_555 ? 10 AC3 4 CYS A 39 ? CYS A 349 . ? 1_555 ? 11 AC3 4 CYS A 63 ? CYS A 373 . ? 1_555 ? 12 AC3 4 CYS A 66 ? CYS A 376 . ? 1_555 ? # _atom_sites.entry_id 2LGK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 311 311 SER SER A . n A 1 2 GLY 2 312 312 GLY GLY A . n A 1 3 PRO 3 313 313 PRO PRO A . n A 1 4 SER 4 314 314 SER SER A . n A 1 5 CYS 5 315 315 CYS CYS A . n A 1 6 LYS 6 316 316 LYS LYS A . n A 1 7 HIS 7 317 317 HIS HIS A . n A 1 8 CYS 8 318 318 CYS CYS A . n A 1 9 LYS 9 319 319 LYS LYS A . n A 1 10 ASP 10 320 320 ASP ASP A . n A 1 11 ASP 11 321 321 ASP ASP A . n A 1 12 VAL 12 322 322 VAL VAL A . n A 1 13 ASN 13 323 323 ASN ASN A . n A 1 14 ARG 14 324 324 ARG ARG A . n A 1 15 LEU 15 325 325 LEU LEU A . n A 1 16 CYS 16 326 326 CYS CYS A . n A 1 17 ARG 17 327 327 ARG ARG A . n A 1 18 VAL 18 328 328 VAL VAL A . n A 1 19 CYS 19 329 329 CYS CYS A . n A 1 20 ALA 20 330 330 ALA ALA A . n A 1 21 CYS 21 331 331 CYS CYS A . n A 1 22 HIS 22 332 332 HIS HIS A . n A 1 23 LEU 23 333 333 LEU LEU A . n A 1 24 CYS 24 334 334 CYS CYS A . n A 1 25 GLY 25 335 335 GLY GLY A . n A 1 26 GLY 26 336 336 GLY GLY A . n A 1 27 ARG 27 337 337 ARG ARG A . n A 1 28 GLN 28 338 338 GLN GLN A . n A 1 29 ASP 29 339 339 ASP ASP A . n A 1 30 PRO 30 340 340 PRO PRO A . n A 1 31 ASP 31 341 341 ASP ASP A . n A 1 32 LYS 32 342 342 LYS LYS A . n A 1 33 GLN 33 343 343 GLN GLN A . n A 1 34 LEU 34 344 344 LEU LEU A . n A 1 35 MET 35 345 345 MET MET A . n A 1 36 CYS 36 346 346 CYS CYS A . n A 1 37 ASP 37 347 347 ASP ASP A . n A 1 38 GLU 38 348 348 GLU GLU A . n A 1 39 CYS 39 349 349 CYS CYS A . n A 1 40 ASP 40 350 350 ASP ASP A . n A 1 41 MET 41 351 351 MET MET A . n A 1 42 ALA 42 352 352 ALA ALA A . n A 1 43 PHE 43 353 353 PHE PHE A . n A 1 44 HIS 44 354 354 HIS HIS A . n A 1 45 ILE 45 355 355 ILE ILE A . n A 1 46 TYR 46 356 356 TYR TYR A . n A 1 47 CYS 47 357 357 CYS CYS A . n A 1 48 LEU 48 358 358 LEU LEU A . n A 1 49 ASP 49 359 359 ASP ASP A . n A 1 50 PRO 50 360 360 PRO PRO A . n A 1 51 PRO 51 361 361 PRO PRO A . n A 1 52 LEU 52 362 362 LEU LEU A . n A 1 53 SER 53 363 363 SER SER A . n A 1 54 SER 54 364 364 SER SER A . n A 1 55 VAL 55 365 365 VAL VAL A . n A 1 56 PRO 56 366 366 PRO PRO A . n A 1 57 SER 57 367 367 SER SER A . n A 1 58 GLU 58 368 368 GLU GLU A . n A 1 59 ASP 59 369 369 ASP ASP A . n A 1 60 GLU 60 370 370 GLU GLU A . n A 1 61 TRP 61 371 371 TRP TRP A . n A 1 62 TYR 62 372 372 TYR TYR A . n A 1 63 CYS 63 373 373 CYS CYS A . n A 1 64 PRO 64 374 374 PRO PRO A . n A 1 65 GLU 65 375 375 GLU GLU A . n A 1 66 CYS 66 376 376 CYS CYS A . n A 1 67 ARG 67 377 377 ARG ARG A . n A 1 68 ASN 68 378 378 ASN ASN A . n A 1 69 ASP 69 379 379 ASP ASP A . n B 2 1 ALA 1 1 1 ALA ALA B . n B 2 2 ARG 2 2 2 ARG ARG B . n B 2 3 THR 3 3 3 THR THR B . n B 2 4 LYS 4 4 4 LYS LYS B . n B 2 5 GLN 5 5 5 GLN GLN B . n B 2 6 THR 6 6 6 THR THR B . n B 2 7 ALA 7 7 7 ALA ALA B . n B 2 8 ARG 8 8 8 ARG ARG B . n B 2 9 M3L 9 9 9 M3L M3L B . n B 2 10 SER 10 10 10 SER SER B . n B 2 11 THR 11 11 11 THR THR B . n B 2 12 GLY 12 12 12 GLY GLY B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ZN 1 380 380 ZN ZN A . D 3 ZN 1 381 381 ZN ZN A . E 3 ZN 1 382 382 ZN ZN A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id M3L _pdbx_struct_mod_residue.label_seq_id 9 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id M3L _pdbx_struct_mod_residue.auth_seq_id 9 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details N-TRIMETHYLLYSINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 5 ? A CYS 315 ? 1_555 ZN ? C ZN . ? A ZN 380 ? 1_555 SG ? A CYS 8 ? A CYS 318 ? 1_555 107.4 ? 2 SG ? A CYS 5 ? A CYS 315 ? 1_555 ZN ? C ZN . ? A ZN 380 ? 1_555 SG ? A CYS 16 ? A CYS 326 ? 1_555 112.3 ? 3 SG ? A CYS 8 ? A CYS 318 ? 1_555 ZN ? C ZN . ? A ZN 380 ? 1_555 SG ? A CYS 16 ? A CYS 326 ? 1_555 111.2 ? 4 SG ? A CYS 5 ? A CYS 315 ? 1_555 ZN ? C ZN . ? A ZN 380 ? 1_555 SG ? A CYS 19 ? A CYS 329 ? 1_555 109.3 ? 5 SG ? A CYS 8 ? A CYS 318 ? 1_555 ZN ? C ZN . ? A ZN 380 ? 1_555 SG ? A CYS 19 ? A CYS 329 ? 1_555 109.7 ? 6 SG ? A CYS 16 ? A CYS 326 ? 1_555 ZN ? C ZN . ? A ZN 380 ? 1_555 SG ? A CYS 19 ? A CYS 329 ? 1_555 107.0 ? 7 SG ? A CYS 21 ? A CYS 331 ? 1_555 ZN ? D ZN . ? A ZN 381 ? 1_555 SG ? A CYS 24 ? A CYS 334 ? 1_555 104.7 ? 8 SG ? A CYS 21 ? A CYS 331 ? 1_555 ZN ? D ZN . ? A ZN 381 ? 1_555 NE2 ? A HIS 44 ? A HIS 354 ? 1_555 110.6 ? 9 SG ? A CYS 24 ? A CYS 334 ? 1_555 ZN ? D ZN . ? A ZN 381 ? 1_555 NE2 ? A HIS 44 ? A HIS 354 ? 1_555 108.6 ? 10 SG ? A CYS 21 ? A CYS 331 ? 1_555 ZN ? D ZN . ? A ZN 381 ? 1_555 SG ? A CYS 47 ? A CYS 357 ? 1_555 110.0 ? 11 SG ? A CYS 24 ? A CYS 334 ? 1_555 ZN ? D ZN . ? A ZN 381 ? 1_555 SG ? A CYS 47 ? A CYS 357 ? 1_555 111.0 ? 12 NE2 ? A HIS 44 ? A HIS 354 ? 1_555 ZN ? D ZN . ? A ZN 381 ? 1_555 SG ? A CYS 47 ? A CYS 357 ? 1_555 111.7 ? 13 SG ? A CYS 36 ? A CYS 346 ? 1_555 ZN ? E ZN . ? A ZN 382 ? 1_555 SG ? A CYS 39 ? A CYS 349 ? 1_555 112.2 ? 14 SG ? A CYS 36 ? A CYS 346 ? 1_555 ZN ? E ZN . ? A ZN 382 ? 1_555 SG ? A CYS 63 ? A CYS 373 ? 1_555 115.2 ? 15 SG ? A CYS 39 ? A CYS 349 ? 1_555 ZN ? E ZN . ? A ZN 382 ? 1_555 SG ? A CYS 63 ? A CYS 373 ? 1_555 109.5 ? 16 SG ? A CYS 36 ? A CYS 346 ? 1_555 ZN ? E ZN . ? A ZN 382 ? 1_555 SG ? A CYS 66 ? A CYS 376 ? 1_555 107.8 ? 17 SG ? A CYS 39 ? A CYS 349 ? 1_555 ZN ? E ZN . ? A ZN 382 ? 1_555 SG ? A CYS 66 ? A CYS 376 ? 1_555 104.8 ? 18 SG ? A CYS 63 ? A CYS 373 ? 1_555 ZN ? E ZN . ? A ZN 382 ? 1_555 SG ? A CYS 66 ? A CYS 376 ? 1_555 106.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-09-28 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_struct_conn_angle 5 2 'Structure model' struct_conn 6 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.value' 18 2 'Structure model' '_struct_conn.pdbx_dist_value' 19 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 20 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 21 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 22 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.022 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.00026 _pdbx_nmr_ensemble_rms.entry_id 2LGK _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity_1-1 1.5 ? mM '[U-100% 13C; U-100% 15N]' 1 entity_2-2 1.8 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LGK _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 5 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 969 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 357 _pdbx_nmr_constraints.NOE_long_range_total_count 137 _pdbx_nmr_constraints.NOE_medium_range_total_count 128 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 329 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 40 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 40 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 HE21 A GLN 343 ? ? HH A TYR 356 ? ? 1.27 2 6 H A CYS 326 ? ? HH22 A ARG 337 ? ? 1.28 3 9 H A TYR 372 ? ? HH21 A ARG 377 ? ? 1.22 4 10 H A TYR 372 ? ? HH21 A ARG 377 ? ? 1.32 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 333 ? ? -87.26 -78.06 2 1 ASP A 339 ? ? -172.77 68.95 3 1 HIS A 354 ? ? -68.65 5.24 4 2 CYS A 334 ? ? 77.66 -40.94 5 2 HIS A 354 ? ? -69.05 2.17 6 3 LEU A 333 ? ? -84.57 -78.46 7 3 GLN A 338 ? ? 30.69 50.97 8 3 ASP A 339 ? ? 73.02 79.45 9 3 PRO A 360 ? ? -57.01 109.33 10 3 M3L B 9 ? ? -72.44 46.67 11 4 LEU A 333 ? ? -84.87 -93.89 12 4 ASP A 339 ? ? -159.34 71.98 13 4 HIS A 354 ? ? -62.07 8.65 14 4 PRO A 360 ? ? -57.78 109.87 15 5 HIS A 354 ? ? -61.62 5.34 16 5 M3L B 9 ? ? -96.54 55.98 17 6 ASP A 339 ? ? -165.84 69.19 18 6 HIS A 354 ? ? -68.36 7.34 19 6 THR B 3 ? ? 60.19 128.90 20 7 LEU A 333 ? ? -95.95 -77.28 21 7 HIS A 354 ? ? -69.13 2.22 22 7 ILE A 355 ? ? -45.69 -19.75 23 7 ASN A 378 ? ? 50.05 6.65 24 7 ARG B 2 ? ? 55.94 112.78 25 8 CYS A 329 ? ? -111.77 69.95 26 8 ARG A 337 ? ? 52.53 93.38 27 8 HIS A 354 ? ? -68.91 9.09 28 8 ILE A 355 ? ? -48.95 -18.99 29 8 PRO A 360 ? ? -56.53 109.98 30 8 M3L B 9 ? ? -63.63 -176.44 31 9 LEU A 333 ? ? -88.50 -91.94 32 9 ARG A 337 ? ? -140.21 47.61 33 9 ASP A 339 ? ? -159.21 69.40 34 9 HIS A 354 ? ? -68.43 5.34 35 9 PRO A 360 ? ? -56.25 109.76 36 10 CYS A 334 ? ? 79.07 -42.38 37 10 ARG A 337 ? ? -150.24 87.85 38 10 HIS A 354 ? ? -69.79 9.02 39 10 M3L B 9 ? ? -50.04 -89.45 40 11 CYS A 329 ? ? -107.80 68.79 41 11 ASP A 339 ? ? 43.07 72.89 42 11 HIS A 354 ? ? -66.75 3.28 43 11 ALA B 7 ? ? 51.09 -154.09 44 12 LEU A 333 ? ? -89.48 -95.90 45 12 GLN A 338 ? ? 35.14 45.83 46 12 ASP A 339 ? ? 77.10 82.68 47 13 CYS A 334 ? ? 73.62 -41.75 48 13 ASP A 339 ? ? 37.94 65.08 49 13 HIS A 354 ? ? -68.83 9.47 50 14 ASP A 321 ? ? -117.31 66.30 51 14 CYS A 334 ? ? 76.93 -41.03 52 14 ASP A 339 ? ? 39.77 66.57 53 14 HIS A 354 ? ? -68.53 9.29 54 15 CYS A 334 ? ? 75.99 -40.14 55 15 HIS A 354 ? ? -68.29 9.16 56 15 M3L B 9 ? ? -140.27 -2.75 57 16 ASP A 321 ? ? -157.49 62.70 58 16 CYS A 334 ? ? 77.17 -40.76 59 16 ASN A 378 ? ? 48.87 7.74 60 17 CYS A 329 ? ? -118.87 70.38 61 17 LEU A 333 ? ? -82.76 -74.41 62 17 PRO A 360 ? ? -56.24 109.70 63 17 ASN A 378 ? ? 52.56 4.83 64 17 THR B 3 ? ? 55.20 156.15 65 17 M3L B 9 ? ? -160.62 108.19 66 18 ASP A 321 ? ? -156.68 71.58 67 18 CYS A 329 ? ? -118.93 69.50 68 18 LEU A 333 ? ? -82.88 -75.18 69 18 ASP A 339 ? ? -163.80 67.66 70 18 HIS A 354 ? ? -68.09 6.38 71 18 PRO A 360 ? ? -57.47 109.83 72 18 THR B 3 ? ? 51.46 172.54 73 19 CYS A 329 ? ? -106.60 68.93 74 19 HIS A 332 ? ? -36.32 -74.62 75 19 LEU A 333 ? ? -67.80 -120.33 76 19 ARG A 337 ? ? 39.67 81.07 77 20 LEU A 333 ? ? -92.64 -76.96 78 20 HIS A 354 ? ? -69.45 4.61 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #