data_2LGW # _entry.id 2LGW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LGW pdb_00002lgw 10.2210/pdb2lgw/pdb RCSB RCSB102377 ? ? BMRB 17825 ? ? WWPDB D_1000102377 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17825 BMRB unspecified . 2LMG PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LGW _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2011-08-02 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhou, C.' 1 'Gao, X.' 2 'Cao, C.' 3 'Hu, H.' 4 # _citation.id primary _citation.title 'The C-terminal helices of heat shock protein 70 are essential for J-domain binding and ATPase activation.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 287 _citation.page_first 6044 _citation.page_last 6052 _citation.year 2012 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 1083-351X _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22219199 _citation.pdbx_database_id_DOI 10.1074/jbc.M111.294728 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gao, X.C.' 1 ? primary 'Zhou, C.J.' 2 ? primary 'Zhou, Z.R.' 3 ? primary 'Wu, M.' 4 ? primary 'Cao, C.Y.' 5 ? primary 'Hu, H.Y.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DnaJ homolog subfamily B member 2' _entity.formula_weight 11297.479 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 1-91' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DnaJ protein homolog 1, Heat shock 40 kDa protein 3, Heat shock protein J1, HSJ-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGREGLTGTGTGP SRAEAGSGGPGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGREGLTGTGTGP SRAEAGSGGPGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 TYR n 1 5 TYR n 1 6 GLU n 1 7 ILE n 1 8 LEU n 1 9 ASP n 1 10 VAL n 1 11 PRO n 1 12 ARG n 1 13 SER n 1 14 ALA n 1 15 SER n 1 16 ALA n 1 17 ASP n 1 18 ASP n 1 19 ILE n 1 20 LYS n 1 21 LYS n 1 22 ALA n 1 23 TYR n 1 24 ARG n 1 25 ARG n 1 26 LYS n 1 27 ALA n 1 28 LEU n 1 29 GLN n 1 30 TRP n 1 31 HIS n 1 32 PRO n 1 33 ASP n 1 34 LYS n 1 35 ASN n 1 36 PRO n 1 37 ASP n 1 38 ASN n 1 39 LYS n 1 40 GLU n 1 41 PHE n 1 42 ALA n 1 43 GLU n 1 44 LYS n 1 45 LYS n 1 46 PHE n 1 47 LYS n 1 48 GLU n 1 49 VAL n 1 50 ALA n 1 51 GLU n 1 52 ALA n 1 53 TYR n 1 54 GLU n 1 55 VAL n 1 56 LEU n 1 57 SER n 1 58 ASP n 1 59 LYS n 1 60 HIS n 1 61 LYS n 1 62 ARG n 1 63 GLU n 1 64 ILE n 1 65 TYR n 1 66 ASP n 1 67 ARG n 1 68 TYR n 1 69 GLY n 1 70 ARG n 1 71 GLU n 1 72 GLY n 1 73 LEU n 1 74 THR n 1 75 GLY n 1 76 THR n 1 77 GLY n 1 78 THR n 1 79 GLY n 1 80 PRO n 1 81 SER n 1 82 ARG n 1 83 ALA n 1 84 GLU n 1 85 ALA n 1 86 GLY n 1 87 SER n 1 88 GLY n 1 89 GLY n 1 90 PRO n 1 91 GLY n 1 92 LEU n 1 93 GLU n 1 94 HIS n 1 95 HIS n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET-22b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DNJB2_HUMAN _struct_ref.pdbx_db_accession P25686 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGREGLTGTGTGP SRAEAGSGGPG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LGW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P25686 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 91 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 91 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LGW LEU A 92 ? UNP P25686 ? ? 'expression tag' 92 1 1 2LGW GLU A 93 ? UNP P25686 ? ? 'expression tag' 93 2 1 2LGW HIS A 94 ? UNP P25686 ? ? 'expression tag' 94 3 1 2LGW HIS A 95 ? UNP P25686 ? ? 'expression tag' 95 4 1 2LGW HIS A 96 ? UNP P25686 ? ? 'expression tag' 96 5 1 2LGW HIS A 97 ? UNP P25686 ? ? 'expression tag' 97 6 1 2LGW HIS A 98 ? UNP P25686 ? ? 'expression tag' 98 7 1 2LGW HIS A 99 ? UNP P25686 ? ? 'expression tag' 99 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '3D HNCACB' 1 3 2 '3D CBCA(CO)NH' 1 4 2 '3D C(CO)NH' 1 5 2 '3D HNCO' 1 6 1 '3D HNHA' 1 7 2 '3D HCCH-TOCSY' 1 8 1 '3D 1H-15N NOESY' 1 9 2 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 15N] protein-1, 20 mM potassium phosphate-2, 50 mM sodium chloride-3, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 13C; U-100% 15N] protein-4, 20 mM potassium phosphate-5, 50 mM sodium chloride-6, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LGW _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LGW _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LGW _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 1 ? 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS 2 ? Goddard 'peak picking' Sparky 3 ? ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 4 ? ;Linge, O'Donoghue and Nilges ; refinement ARIA 5 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LGW _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LGW _struct.title 'Solution Structure of the J Domain of HSJ1a' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LGW _struct_keywords.pdbx_keywords CHAPERONE _struct_keywords.text 'J domain, HSJ1a, co-chaperon, CHAPERONE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? LEU A 8 ? SER A 3 LEU A 8 1 ? 6 HELX_P HELX_P2 2 SER A 15 ? TRP A 30 ? SER A 15 TRP A 30 1 ? 16 HELX_P HELX_P3 3 LYS A 39 ? ASP A 58 ? LYS A 39 ASP A 58 1 ? 20 HELX_P HELX_P4 4 ASP A 58 ? GLU A 71 ? ASP A 58 GLU A 71 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2LGW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 GLY 72 72 ? ? ? A . n A 1 73 LEU 73 73 ? ? ? A . n A 1 74 THR 74 74 ? ? ? A . n A 1 75 GLY 75 75 ? ? ? A . n A 1 76 THR 76 76 ? ? ? A . n A 1 77 GLY 77 77 ? ? ? A . n A 1 78 THR 78 78 ? ? ? A . n A 1 79 GLY 79 79 ? ? ? A . n A 1 80 PRO 80 80 ? ? ? A . n A 1 81 SER 81 81 ? ? ? A . n A 1 82 ARG 82 82 ? ? ? A . n A 1 83 ALA 83 83 ? ? ? A . n A 1 84 GLU 84 84 ? ? ? A . n A 1 85 ALA 85 85 ? ? ? A . n A 1 86 GLY 86 86 ? ? ? A . n A 1 87 SER 87 87 ? ? ? A . n A 1 88 GLY 88 88 ? ? ? A . n A 1 89 GLY 89 89 ? ? ? A . n A 1 90 PRO 90 90 ? ? ? A . n A 1 91 GLY 91 91 ? ? ? A . n A 1 92 LEU 92 92 ? ? ? A . n A 1 93 GLU 93 93 ? ? ? A . n A 1 94 HIS 94 94 ? ? ? A . n A 1 95 HIS 95 95 ? ? ? A . n A 1 96 HIS 96 96 ? ? ? A . n A 1 97 HIS 97 97 ? ? ? A . n A 1 98 HIS 98 98 ? ? ? A . n A 1 99 HIS 99 99 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-01-11 2 'Structure model' 1 1 2019-12-25 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' struct_ref_seq_dif 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.name' 7 2 'Structure model' '_pdbx_nmr_software.name' 8 2 'Structure model' '_struct_ref_seq_dif.details' 9 3 'Structure model' '_database_2.pdbx_DOI' 10 3 'Structure model' '_database_2.pdbx_database_accession' 11 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1 ? mM '[U-100% 15N]' 1 'potassium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 50 ? mM ? 1 entity-4 1 ? mM '[U-100% 13C; U-100% 15N]' 2 'potassium phosphate-5' 20 ? mM ? 2 'sodium chloride-6' 50 ? mM ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 54 ? ? HZ2 A LYS 61 ? ? 1.58 2 2 HD1 A HIS 31 ? ? OD1 A ASP 33 ? ? 1.56 3 4 HD1 A TYR 23 ? ? HG23 A VAL 49 ? ? 1.34 4 6 HZ2 A LYS 26 ? ? OE2 A GLU 48 ? ? 1.58 5 7 OE2 A GLU 54 ? ? HZ2 A LYS 61 ? ? 1.58 6 8 HZ3 A LYS 59 ? ? OE2 A GLU 63 ? ? 1.57 7 8 HD1 A HIS 31 ? ? OD1 A ASP 33 ? ? 1.57 8 9 HD1 A TYR 23 ? ? HG23 A VAL 49 ? ? 1.25 9 9 H3 A MET 1 ? ? OD1 A ASP 66 ? ? 1.59 10 11 OE1 A GLU 40 ? ? HZ2 A LYS 44 ? ? 1.57 11 13 HZ1 A LYS 47 ? ? OE1 A GLU 51 ? ? 1.56 12 14 HD1 A HIS 31 ? ? OD1 A ASP 33 ? ? 1.58 13 15 HD1 A HIS 31 ? ? OD1 A ASP 33 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? 67.64 -7.12 2 1 LEU A 8 ? ? -101.67 -106.08 3 1 ASP A 9 ? ? -140.53 -35.71 4 1 SER A 13 ? ? -176.65 -37.21 5 1 PRO A 36 ? ? -87.34 -119.52 6 2 SER A 3 ? ? 66.62 -2.28 7 2 LEU A 8 ? ? -97.39 -78.37 8 2 ASP A 9 ? ? 177.56 -44.01 9 2 PRO A 36 ? ? -81.26 -120.92 10 3 ALA A 2 ? ? 70.59 -72.69 11 3 LEU A 8 ? ? -102.58 -104.02 12 3 ASP A 9 ? ? -158.48 -22.65 13 3 PRO A 11 ? ? -59.30 -81.79 14 3 ARG A 12 ? ? -171.32 -35.88 15 3 PRO A 36 ? ? -92.19 -104.50 16 4 ALA A 2 ? ? 56.68 72.65 17 4 SER A 3 ? ? -68.75 3.62 18 4 LEU A 8 ? ? -100.59 -90.56 19 4 ASP A 9 ? ? 171.10 -16.04 20 4 PRO A 36 ? ? -78.02 -117.76 21 5 LEU A 8 ? ? -102.29 -93.08 22 5 ASP A 9 ? ? 174.27 3.85 23 5 PRO A 36 ? ? -73.61 -115.84 24 6 LEU A 8 ? ? -103.85 -75.30 25 6 ASP A 9 ? ? 168.95 -30.56 26 6 PRO A 36 ? ? -96.56 -112.04 27 7 ALA A 2 ? ? -142.18 -48.09 28 7 SER A 3 ? ? 58.61 0.69 29 7 LEU A 8 ? ? -99.36 -79.69 30 7 ASP A 9 ? ? 176.35 -41.02 31 7 PRO A 36 ? ? -81.44 -120.39 32 8 ALA A 2 ? ? -171.05 -49.70 33 8 SER A 3 ? ? 69.34 -6.56 34 8 LEU A 8 ? ? -101.01 -93.97 35 8 ASP A 9 ? ? -178.72 -19.87 36 8 PRO A 36 ? ? -82.73 -110.17 37 9 LEU A 8 ? ? -93.34 -75.61 38 9 ASP A 9 ? ? 171.58 -24.48 39 9 PRO A 36 ? ? -71.12 -119.23 40 10 SER A 3 ? ? -73.72 33.02 41 10 LEU A 8 ? ? -97.66 -79.94 42 10 ASP A 9 ? ? 174.73 -40.56 43 10 PRO A 36 ? ? -74.89 -120.93 44 11 SER A 3 ? ? -81.47 31.36 45 11 LEU A 8 ? ? -101.47 -82.27 46 11 ASP A 9 ? ? 174.08 -29.63 47 11 PRO A 36 ? ? -91.10 -101.04 48 12 ALA A 2 ? ? 69.72 -63.66 49 12 SER A 3 ? ? 65.83 -4.04 50 12 LEU A 8 ? ? -100.72 -84.62 51 12 ASP A 9 ? ? 176.35 -33.24 52 12 PRO A 36 ? ? -81.79 -110.78 53 13 LEU A 8 ? ? -102.83 -74.82 54 13 ASP A 9 ? ? 172.07 -31.25 55 13 PRO A 36 ? ? -89.04 -107.81 56 14 LEU A 8 ? ? -99.89 -87.81 57 14 ASP A 9 ? ? 170.65 -11.28 58 14 PRO A 36 ? ? -88.12 -106.96 59 15 SER A 3 ? ? 68.59 -14.09 60 15 LEU A 8 ? ? -99.66 -87.03 61 15 ASP A 9 ? ? 177.85 -33.18 62 15 PRO A 36 ? ? -85.73 -121.93 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 72 ? A GLY 72 2 1 Y 1 A LEU 73 ? A LEU 73 3 1 Y 1 A THR 74 ? A THR 74 4 1 Y 1 A GLY 75 ? A GLY 75 5 1 Y 1 A THR 76 ? A THR 76 6 1 Y 1 A GLY 77 ? A GLY 77 7 1 Y 1 A THR 78 ? A THR 78 8 1 Y 1 A GLY 79 ? A GLY 79 9 1 Y 1 A PRO 80 ? A PRO 80 10 1 Y 1 A SER 81 ? A SER 81 11 1 Y 1 A ARG 82 ? A ARG 82 12 1 Y 1 A ALA 83 ? A ALA 83 13 1 Y 1 A GLU 84 ? A GLU 84 14 1 Y 1 A ALA 85 ? A ALA 85 15 1 Y 1 A GLY 86 ? A GLY 86 16 1 Y 1 A SER 87 ? A SER 87 17 1 Y 1 A GLY 88 ? A GLY 88 18 1 Y 1 A GLY 89 ? A GLY 89 19 1 Y 1 A PRO 90 ? A PRO 90 20 1 Y 1 A GLY 91 ? A GLY 91 21 1 Y 1 A LEU 92 ? A LEU 92 22 1 Y 1 A GLU 93 ? A GLU 93 23 1 Y 1 A HIS 94 ? A HIS 94 24 1 Y 1 A HIS 95 ? A HIS 95 25 1 Y 1 A HIS 96 ? A HIS 96 26 1 Y 1 A HIS 97 ? A HIS 97 27 1 Y 1 A HIS 98 ? A HIS 98 28 1 Y 1 A HIS 99 ? A HIS 99 29 2 Y 1 A GLY 72 ? A GLY 72 30 2 Y 1 A LEU 73 ? A LEU 73 31 2 Y 1 A THR 74 ? A THR 74 32 2 Y 1 A GLY 75 ? A GLY 75 33 2 Y 1 A THR 76 ? A THR 76 34 2 Y 1 A GLY 77 ? A GLY 77 35 2 Y 1 A THR 78 ? A THR 78 36 2 Y 1 A GLY 79 ? A GLY 79 37 2 Y 1 A PRO 80 ? A PRO 80 38 2 Y 1 A SER 81 ? A SER 81 39 2 Y 1 A ARG 82 ? A ARG 82 40 2 Y 1 A ALA 83 ? A ALA 83 41 2 Y 1 A GLU 84 ? A GLU 84 42 2 Y 1 A ALA 85 ? A ALA 85 43 2 Y 1 A GLY 86 ? A GLY 86 44 2 Y 1 A SER 87 ? A SER 87 45 2 Y 1 A GLY 88 ? A GLY 88 46 2 Y 1 A GLY 89 ? A GLY 89 47 2 Y 1 A PRO 90 ? A PRO 90 48 2 Y 1 A GLY 91 ? A GLY 91 49 2 Y 1 A LEU 92 ? A LEU 92 50 2 Y 1 A GLU 93 ? A GLU 93 51 2 Y 1 A HIS 94 ? A HIS 94 52 2 Y 1 A HIS 95 ? A HIS 95 53 2 Y 1 A HIS 96 ? A HIS 96 54 2 Y 1 A HIS 97 ? A HIS 97 55 2 Y 1 A HIS 98 ? A HIS 98 56 2 Y 1 A HIS 99 ? A HIS 99 57 3 Y 1 A GLY 72 ? A GLY 72 58 3 Y 1 A LEU 73 ? A LEU 73 59 3 Y 1 A THR 74 ? A THR 74 60 3 Y 1 A GLY 75 ? A GLY 75 61 3 Y 1 A THR 76 ? A THR 76 62 3 Y 1 A GLY 77 ? A GLY 77 63 3 Y 1 A THR 78 ? A THR 78 64 3 Y 1 A GLY 79 ? A GLY 79 65 3 Y 1 A PRO 80 ? A PRO 80 66 3 Y 1 A SER 81 ? A SER 81 67 3 Y 1 A ARG 82 ? A ARG 82 68 3 Y 1 A ALA 83 ? A ALA 83 69 3 Y 1 A GLU 84 ? A GLU 84 70 3 Y 1 A ALA 85 ? A ALA 85 71 3 Y 1 A GLY 86 ? A GLY 86 72 3 Y 1 A SER 87 ? A SER 87 73 3 Y 1 A GLY 88 ? A GLY 88 74 3 Y 1 A GLY 89 ? A GLY 89 75 3 Y 1 A PRO 90 ? A PRO 90 76 3 Y 1 A GLY 91 ? A GLY 91 77 3 Y 1 A LEU 92 ? A LEU 92 78 3 Y 1 A GLU 93 ? A GLU 93 79 3 Y 1 A HIS 94 ? A HIS 94 80 3 Y 1 A HIS 95 ? A HIS 95 81 3 Y 1 A HIS 96 ? A HIS 96 82 3 Y 1 A HIS 97 ? A HIS 97 83 3 Y 1 A HIS 98 ? A HIS 98 84 3 Y 1 A HIS 99 ? A HIS 99 85 4 Y 1 A GLY 72 ? A GLY 72 86 4 Y 1 A LEU 73 ? A LEU 73 87 4 Y 1 A THR 74 ? A THR 74 88 4 Y 1 A GLY 75 ? A GLY 75 89 4 Y 1 A THR 76 ? A THR 76 90 4 Y 1 A GLY 77 ? A GLY 77 91 4 Y 1 A THR 78 ? A THR 78 92 4 Y 1 A GLY 79 ? A GLY 79 93 4 Y 1 A PRO 80 ? A PRO 80 94 4 Y 1 A SER 81 ? A SER 81 95 4 Y 1 A ARG 82 ? A ARG 82 96 4 Y 1 A ALA 83 ? A ALA 83 97 4 Y 1 A GLU 84 ? A GLU 84 98 4 Y 1 A ALA 85 ? A ALA 85 99 4 Y 1 A GLY 86 ? A GLY 86 100 4 Y 1 A SER 87 ? A SER 87 101 4 Y 1 A GLY 88 ? A GLY 88 102 4 Y 1 A GLY 89 ? A GLY 89 103 4 Y 1 A PRO 90 ? A PRO 90 104 4 Y 1 A GLY 91 ? A GLY 91 105 4 Y 1 A LEU 92 ? A LEU 92 106 4 Y 1 A GLU 93 ? A GLU 93 107 4 Y 1 A HIS 94 ? A HIS 94 108 4 Y 1 A HIS 95 ? A HIS 95 109 4 Y 1 A HIS 96 ? A HIS 96 110 4 Y 1 A HIS 97 ? A HIS 97 111 4 Y 1 A HIS 98 ? A HIS 98 112 4 Y 1 A HIS 99 ? A HIS 99 113 5 Y 1 A GLY 72 ? A GLY 72 114 5 Y 1 A LEU 73 ? A LEU 73 115 5 Y 1 A THR 74 ? A THR 74 116 5 Y 1 A GLY 75 ? A GLY 75 117 5 Y 1 A THR 76 ? A THR 76 118 5 Y 1 A GLY 77 ? A GLY 77 119 5 Y 1 A THR 78 ? A THR 78 120 5 Y 1 A GLY 79 ? A GLY 79 121 5 Y 1 A PRO 80 ? A PRO 80 122 5 Y 1 A SER 81 ? A SER 81 123 5 Y 1 A ARG 82 ? A ARG 82 124 5 Y 1 A ALA 83 ? A ALA 83 125 5 Y 1 A GLU 84 ? A GLU 84 126 5 Y 1 A ALA 85 ? A ALA 85 127 5 Y 1 A GLY 86 ? A GLY 86 128 5 Y 1 A SER 87 ? A SER 87 129 5 Y 1 A GLY 88 ? A GLY 88 130 5 Y 1 A GLY 89 ? A GLY 89 131 5 Y 1 A PRO 90 ? A PRO 90 132 5 Y 1 A GLY 91 ? A GLY 91 133 5 Y 1 A LEU 92 ? A LEU 92 134 5 Y 1 A GLU 93 ? A GLU 93 135 5 Y 1 A HIS 94 ? A HIS 94 136 5 Y 1 A HIS 95 ? A HIS 95 137 5 Y 1 A HIS 96 ? A HIS 96 138 5 Y 1 A HIS 97 ? A HIS 97 139 5 Y 1 A HIS 98 ? A HIS 98 140 5 Y 1 A HIS 99 ? A HIS 99 141 6 Y 1 A GLY 72 ? A GLY 72 142 6 Y 1 A LEU 73 ? A LEU 73 143 6 Y 1 A THR 74 ? A THR 74 144 6 Y 1 A GLY 75 ? A GLY 75 145 6 Y 1 A THR 76 ? A THR 76 146 6 Y 1 A GLY 77 ? A GLY 77 147 6 Y 1 A THR 78 ? A THR 78 148 6 Y 1 A GLY 79 ? A GLY 79 149 6 Y 1 A PRO 80 ? A PRO 80 150 6 Y 1 A SER 81 ? A SER 81 151 6 Y 1 A ARG 82 ? A ARG 82 152 6 Y 1 A ALA 83 ? A ALA 83 153 6 Y 1 A GLU 84 ? A GLU 84 154 6 Y 1 A ALA 85 ? A ALA 85 155 6 Y 1 A GLY 86 ? A GLY 86 156 6 Y 1 A SER 87 ? A SER 87 157 6 Y 1 A GLY 88 ? A GLY 88 158 6 Y 1 A GLY 89 ? A GLY 89 159 6 Y 1 A PRO 90 ? A PRO 90 160 6 Y 1 A GLY 91 ? A GLY 91 161 6 Y 1 A LEU 92 ? A LEU 92 162 6 Y 1 A GLU 93 ? A GLU 93 163 6 Y 1 A HIS 94 ? A HIS 94 164 6 Y 1 A HIS 95 ? A HIS 95 165 6 Y 1 A HIS 96 ? A HIS 96 166 6 Y 1 A HIS 97 ? A HIS 97 167 6 Y 1 A HIS 98 ? A HIS 98 168 6 Y 1 A HIS 99 ? A HIS 99 169 7 Y 1 A GLY 72 ? A GLY 72 170 7 Y 1 A LEU 73 ? A LEU 73 171 7 Y 1 A THR 74 ? A THR 74 172 7 Y 1 A GLY 75 ? A GLY 75 173 7 Y 1 A THR 76 ? A THR 76 174 7 Y 1 A GLY 77 ? A GLY 77 175 7 Y 1 A THR 78 ? A THR 78 176 7 Y 1 A GLY 79 ? A GLY 79 177 7 Y 1 A PRO 80 ? A PRO 80 178 7 Y 1 A SER 81 ? A SER 81 179 7 Y 1 A ARG 82 ? A ARG 82 180 7 Y 1 A ALA 83 ? A ALA 83 181 7 Y 1 A GLU 84 ? A GLU 84 182 7 Y 1 A ALA 85 ? A ALA 85 183 7 Y 1 A GLY 86 ? A GLY 86 184 7 Y 1 A SER 87 ? A SER 87 185 7 Y 1 A GLY 88 ? A GLY 88 186 7 Y 1 A GLY 89 ? A GLY 89 187 7 Y 1 A PRO 90 ? A PRO 90 188 7 Y 1 A GLY 91 ? A GLY 91 189 7 Y 1 A LEU 92 ? A LEU 92 190 7 Y 1 A GLU 93 ? A GLU 93 191 7 Y 1 A HIS 94 ? A HIS 94 192 7 Y 1 A HIS 95 ? A HIS 95 193 7 Y 1 A HIS 96 ? A HIS 96 194 7 Y 1 A HIS 97 ? A HIS 97 195 7 Y 1 A HIS 98 ? A HIS 98 196 7 Y 1 A HIS 99 ? A HIS 99 197 8 Y 1 A GLY 72 ? A GLY 72 198 8 Y 1 A LEU 73 ? A LEU 73 199 8 Y 1 A THR 74 ? A THR 74 200 8 Y 1 A GLY 75 ? A GLY 75 201 8 Y 1 A THR 76 ? A THR 76 202 8 Y 1 A GLY 77 ? A GLY 77 203 8 Y 1 A THR 78 ? A THR 78 204 8 Y 1 A GLY 79 ? A GLY 79 205 8 Y 1 A PRO 80 ? A PRO 80 206 8 Y 1 A SER 81 ? A SER 81 207 8 Y 1 A ARG 82 ? A ARG 82 208 8 Y 1 A ALA 83 ? A ALA 83 209 8 Y 1 A GLU 84 ? A GLU 84 210 8 Y 1 A ALA 85 ? A ALA 85 211 8 Y 1 A GLY 86 ? A GLY 86 212 8 Y 1 A SER 87 ? A SER 87 213 8 Y 1 A GLY 88 ? A GLY 88 214 8 Y 1 A GLY 89 ? A GLY 89 215 8 Y 1 A PRO 90 ? A PRO 90 216 8 Y 1 A GLY 91 ? A GLY 91 217 8 Y 1 A LEU 92 ? A LEU 92 218 8 Y 1 A GLU 93 ? A GLU 93 219 8 Y 1 A HIS 94 ? A HIS 94 220 8 Y 1 A HIS 95 ? A HIS 95 221 8 Y 1 A HIS 96 ? A HIS 96 222 8 Y 1 A HIS 97 ? A HIS 97 223 8 Y 1 A HIS 98 ? A HIS 98 224 8 Y 1 A HIS 99 ? A HIS 99 225 9 Y 1 A GLY 72 ? A GLY 72 226 9 Y 1 A LEU 73 ? A LEU 73 227 9 Y 1 A THR 74 ? A THR 74 228 9 Y 1 A GLY 75 ? A GLY 75 229 9 Y 1 A THR 76 ? A THR 76 230 9 Y 1 A GLY 77 ? A GLY 77 231 9 Y 1 A THR 78 ? A THR 78 232 9 Y 1 A GLY 79 ? A GLY 79 233 9 Y 1 A PRO 80 ? A PRO 80 234 9 Y 1 A SER 81 ? A SER 81 235 9 Y 1 A ARG 82 ? A ARG 82 236 9 Y 1 A ALA 83 ? A ALA 83 237 9 Y 1 A GLU 84 ? A GLU 84 238 9 Y 1 A ALA 85 ? A ALA 85 239 9 Y 1 A GLY 86 ? A GLY 86 240 9 Y 1 A SER 87 ? A SER 87 241 9 Y 1 A GLY 88 ? A GLY 88 242 9 Y 1 A GLY 89 ? A GLY 89 243 9 Y 1 A PRO 90 ? A PRO 90 244 9 Y 1 A GLY 91 ? A GLY 91 245 9 Y 1 A LEU 92 ? A LEU 92 246 9 Y 1 A GLU 93 ? A GLU 93 247 9 Y 1 A HIS 94 ? A HIS 94 248 9 Y 1 A HIS 95 ? A HIS 95 249 9 Y 1 A HIS 96 ? A HIS 96 250 9 Y 1 A HIS 97 ? A HIS 97 251 9 Y 1 A HIS 98 ? A HIS 98 252 9 Y 1 A HIS 99 ? A HIS 99 253 10 Y 1 A GLY 72 ? A GLY 72 254 10 Y 1 A LEU 73 ? A LEU 73 255 10 Y 1 A THR 74 ? A THR 74 256 10 Y 1 A GLY 75 ? A GLY 75 257 10 Y 1 A THR 76 ? A THR 76 258 10 Y 1 A GLY 77 ? A GLY 77 259 10 Y 1 A THR 78 ? A THR 78 260 10 Y 1 A GLY 79 ? A GLY 79 261 10 Y 1 A PRO 80 ? A PRO 80 262 10 Y 1 A SER 81 ? A SER 81 263 10 Y 1 A ARG 82 ? A ARG 82 264 10 Y 1 A ALA 83 ? A ALA 83 265 10 Y 1 A GLU 84 ? A GLU 84 266 10 Y 1 A ALA 85 ? A ALA 85 267 10 Y 1 A GLY 86 ? A GLY 86 268 10 Y 1 A SER 87 ? A SER 87 269 10 Y 1 A GLY 88 ? A GLY 88 270 10 Y 1 A GLY 89 ? A GLY 89 271 10 Y 1 A PRO 90 ? A PRO 90 272 10 Y 1 A GLY 91 ? A GLY 91 273 10 Y 1 A LEU 92 ? A LEU 92 274 10 Y 1 A GLU 93 ? A GLU 93 275 10 Y 1 A HIS 94 ? A HIS 94 276 10 Y 1 A HIS 95 ? A HIS 95 277 10 Y 1 A HIS 96 ? A HIS 96 278 10 Y 1 A HIS 97 ? A HIS 97 279 10 Y 1 A HIS 98 ? A HIS 98 280 10 Y 1 A HIS 99 ? A HIS 99 281 11 Y 1 A GLY 72 ? A GLY 72 282 11 Y 1 A LEU 73 ? A LEU 73 283 11 Y 1 A THR 74 ? A THR 74 284 11 Y 1 A GLY 75 ? A GLY 75 285 11 Y 1 A THR 76 ? A THR 76 286 11 Y 1 A GLY 77 ? A GLY 77 287 11 Y 1 A THR 78 ? A THR 78 288 11 Y 1 A GLY 79 ? A GLY 79 289 11 Y 1 A PRO 80 ? A PRO 80 290 11 Y 1 A SER 81 ? A SER 81 291 11 Y 1 A ARG 82 ? A ARG 82 292 11 Y 1 A ALA 83 ? A ALA 83 293 11 Y 1 A GLU 84 ? A GLU 84 294 11 Y 1 A ALA 85 ? A ALA 85 295 11 Y 1 A GLY 86 ? A GLY 86 296 11 Y 1 A SER 87 ? A SER 87 297 11 Y 1 A GLY 88 ? A GLY 88 298 11 Y 1 A GLY 89 ? A GLY 89 299 11 Y 1 A PRO 90 ? A PRO 90 300 11 Y 1 A GLY 91 ? A GLY 91 301 11 Y 1 A LEU 92 ? A LEU 92 302 11 Y 1 A GLU 93 ? A GLU 93 303 11 Y 1 A HIS 94 ? A HIS 94 304 11 Y 1 A HIS 95 ? A HIS 95 305 11 Y 1 A HIS 96 ? A HIS 96 306 11 Y 1 A HIS 97 ? A HIS 97 307 11 Y 1 A HIS 98 ? A HIS 98 308 11 Y 1 A HIS 99 ? A HIS 99 309 12 Y 1 A GLY 72 ? A GLY 72 310 12 Y 1 A LEU 73 ? A LEU 73 311 12 Y 1 A THR 74 ? A THR 74 312 12 Y 1 A GLY 75 ? A GLY 75 313 12 Y 1 A THR 76 ? A THR 76 314 12 Y 1 A GLY 77 ? A GLY 77 315 12 Y 1 A THR 78 ? A THR 78 316 12 Y 1 A GLY 79 ? A GLY 79 317 12 Y 1 A PRO 80 ? A PRO 80 318 12 Y 1 A SER 81 ? A SER 81 319 12 Y 1 A ARG 82 ? A ARG 82 320 12 Y 1 A ALA 83 ? A ALA 83 321 12 Y 1 A GLU 84 ? A GLU 84 322 12 Y 1 A ALA 85 ? A ALA 85 323 12 Y 1 A GLY 86 ? A GLY 86 324 12 Y 1 A SER 87 ? A SER 87 325 12 Y 1 A GLY 88 ? A GLY 88 326 12 Y 1 A GLY 89 ? A GLY 89 327 12 Y 1 A PRO 90 ? A PRO 90 328 12 Y 1 A GLY 91 ? A GLY 91 329 12 Y 1 A LEU 92 ? A LEU 92 330 12 Y 1 A GLU 93 ? A GLU 93 331 12 Y 1 A HIS 94 ? A HIS 94 332 12 Y 1 A HIS 95 ? A HIS 95 333 12 Y 1 A HIS 96 ? A HIS 96 334 12 Y 1 A HIS 97 ? A HIS 97 335 12 Y 1 A HIS 98 ? A HIS 98 336 12 Y 1 A HIS 99 ? A HIS 99 337 13 Y 1 A GLY 72 ? A GLY 72 338 13 Y 1 A LEU 73 ? A LEU 73 339 13 Y 1 A THR 74 ? A THR 74 340 13 Y 1 A GLY 75 ? A GLY 75 341 13 Y 1 A THR 76 ? A THR 76 342 13 Y 1 A GLY 77 ? A GLY 77 343 13 Y 1 A THR 78 ? A THR 78 344 13 Y 1 A GLY 79 ? A GLY 79 345 13 Y 1 A PRO 80 ? A PRO 80 346 13 Y 1 A SER 81 ? A SER 81 347 13 Y 1 A ARG 82 ? A ARG 82 348 13 Y 1 A ALA 83 ? A ALA 83 349 13 Y 1 A GLU 84 ? A GLU 84 350 13 Y 1 A ALA 85 ? A ALA 85 351 13 Y 1 A GLY 86 ? A GLY 86 352 13 Y 1 A SER 87 ? A SER 87 353 13 Y 1 A GLY 88 ? A GLY 88 354 13 Y 1 A GLY 89 ? A GLY 89 355 13 Y 1 A PRO 90 ? A PRO 90 356 13 Y 1 A GLY 91 ? A GLY 91 357 13 Y 1 A LEU 92 ? A LEU 92 358 13 Y 1 A GLU 93 ? A GLU 93 359 13 Y 1 A HIS 94 ? A HIS 94 360 13 Y 1 A HIS 95 ? A HIS 95 361 13 Y 1 A HIS 96 ? A HIS 96 362 13 Y 1 A HIS 97 ? A HIS 97 363 13 Y 1 A HIS 98 ? A HIS 98 364 13 Y 1 A HIS 99 ? A HIS 99 365 14 Y 1 A GLY 72 ? A GLY 72 366 14 Y 1 A LEU 73 ? A LEU 73 367 14 Y 1 A THR 74 ? A THR 74 368 14 Y 1 A GLY 75 ? A GLY 75 369 14 Y 1 A THR 76 ? A THR 76 370 14 Y 1 A GLY 77 ? A GLY 77 371 14 Y 1 A THR 78 ? A THR 78 372 14 Y 1 A GLY 79 ? A GLY 79 373 14 Y 1 A PRO 80 ? A PRO 80 374 14 Y 1 A SER 81 ? A SER 81 375 14 Y 1 A ARG 82 ? A ARG 82 376 14 Y 1 A ALA 83 ? A ALA 83 377 14 Y 1 A GLU 84 ? A GLU 84 378 14 Y 1 A ALA 85 ? A ALA 85 379 14 Y 1 A GLY 86 ? A GLY 86 380 14 Y 1 A SER 87 ? A SER 87 381 14 Y 1 A GLY 88 ? A GLY 88 382 14 Y 1 A GLY 89 ? A GLY 89 383 14 Y 1 A PRO 90 ? A PRO 90 384 14 Y 1 A GLY 91 ? A GLY 91 385 14 Y 1 A LEU 92 ? A LEU 92 386 14 Y 1 A GLU 93 ? A GLU 93 387 14 Y 1 A HIS 94 ? A HIS 94 388 14 Y 1 A HIS 95 ? A HIS 95 389 14 Y 1 A HIS 96 ? A HIS 96 390 14 Y 1 A HIS 97 ? A HIS 97 391 14 Y 1 A HIS 98 ? A HIS 98 392 14 Y 1 A HIS 99 ? A HIS 99 393 15 Y 1 A GLY 72 ? A GLY 72 394 15 Y 1 A LEU 73 ? A LEU 73 395 15 Y 1 A THR 74 ? A THR 74 396 15 Y 1 A GLY 75 ? A GLY 75 397 15 Y 1 A THR 76 ? A THR 76 398 15 Y 1 A GLY 77 ? A GLY 77 399 15 Y 1 A THR 78 ? A THR 78 400 15 Y 1 A GLY 79 ? A GLY 79 401 15 Y 1 A PRO 80 ? A PRO 80 402 15 Y 1 A SER 81 ? A SER 81 403 15 Y 1 A ARG 82 ? A ARG 82 404 15 Y 1 A ALA 83 ? A ALA 83 405 15 Y 1 A GLU 84 ? A GLU 84 406 15 Y 1 A ALA 85 ? A ALA 85 407 15 Y 1 A GLY 86 ? A GLY 86 408 15 Y 1 A SER 87 ? A SER 87 409 15 Y 1 A GLY 88 ? A GLY 88 410 15 Y 1 A GLY 89 ? A GLY 89 411 15 Y 1 A PRO 90 ? A PRO 90 412 15 Y 1 A GLY 91 ? A GLY 91 413 15 Y 1 A LEU 92 ? A LEU 92 414 15 Y 1 A GLU 93 ? A GLU 93 415 15 Y 1 A HIS 94 ? A HIS 94 416 15 Y 1 A HIS 95 ? A HIS 95 417 15 Y 1 A HIS 96 ? A HIS 96 418 15 Y 1 A HIS 97 ? A HIS 97 419 15 Y 1 A HIS 98 ? A HIS 98 420 15 Y 1 A HIS 99 ? A HIS 99 #