data_2LIW # _entry.id 2LIW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LIW RCSB RCSB102436 BMRB 17907 WWPDB D_1000102436 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17907 BMRB unspecified . 2LIU PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LIW _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-09-01 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Busche, A.E.' 1 'Gottstein, D.' 2 'Hein, C.' 3 'Ripin, N.' 4 'Pader, I.' 5 'Tufar, P.' 6 'Eisman, E.B.' 7 'Gu, L.' 8 'Walsh, C.T.' 9 'Loehr, F.' 10 'Sherman, D.H.' 11 'Guntert, P.' 12 'Dotsch, V.' 13 # _citation.id primary _citation.title 'Characterization of Molecular Interactions between ACP and Halogenase Domains in the Curacin A Polyketide Synthase.' _citation.journal_abbrev 'Acs Chem.Biol.' _citation.journal_volume 7 _citation.page_first 378 _citation.page_last 386 _citation.year 2012 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1554-8929 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22103656 _citation.pdbx_database_id_DOI 10.1021/cb200352q # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Busche, A.' 1 primary 'Gottstein, D.' 2 primary 'Hein, C.' 3 primary 'Ripin, N.' 4 primary 'Pader, I.' 5 primary 'Tufar, P.' 6 primary 'Eisman, E.B.' 7 primary 'Gu, L.' 8 primary 'Walsh, C.T.' 9 primary 'Sherman, D.H.' 10 primary 'Lohr, F.' 11 primary 'Guntert, P.' 12 primary 'Dotsch, V.' 13 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man CurA 11009.310 1 ? ? 'UNP residues 1946-2034' ? 2 non-polymer syn "4'-PHOSPHOPANTETHEINE" 358.348 1 ? ? ? ? 3 non-polymer syn '3-HYDROXY-3-METHYL-GLUTARIC ACID' 162.141 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SGLVPRGSHMTPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDY PTLLELSGYIAQILSSQGT ; _entity_poly.pdbx_seq_one_letter_code_can ;SGLVPRGSHMTPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDY PTLLELSGYIAQILSSQGT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 LEU n 1 4 VAL n 1 5 PRO n 1 6 ARG n 1 7 GLY n 1 8 SER n 1 9 HIS n 1 10 MET n 1 11 THR n 1 12 PRO n 1 13 GLN n 1 14 VAL n 1 15 ASN n 1 16 GLN n 1 17 VAL n 1 18 ASN n 1 19 LEU n 1 20 SER n 1 21 GLU n 1 22 ILE n 1 23 LYS n 1 24 GLN n 1 25 VAL n 1 26 LEU n 1 27 LYS n 1 28 GLN n 1 29 GLN n 1 30 LEU n 1 31 ALA n 1 32 GLU n 1 33 ALA n 1 34 LEU n 1 35 TYR n 1 36 THR n 1 37 GLU n 1 38 GLU n 1 39 SER n 1 40 GLU n 1 41 ILE n 1 42 ALA n 1 43 GLU n 1 44 ASP n 1 45 GLN n 1 46 LYS n 1 47 PHE n 1 48 VAL n 1 49 ASP n 1 50 LEU n 1 51 GLY n 1 52 LEU n 1 53 ASP n 1 54 SER n 1 55 ILE n 1 56 VAL n 1 57 GLY n 1 58 VAL n 1 59 GLU n 1 60 TRP n 1 61 THR n 1 62 THR n 1 63 THR n 1 64 ILE n 1 65 ASN n 1 66 GLN n 1 67 THR n 1 68 TYR n 1 69 ASN n 1 70 LEU n 1 71 ASN n 1 72 LEU n 1 73 LYS n 1 74 ALA n 1 75 THR n 1 76 LYS n 1 77 LEU n 1 78 TYR n 1 79 ASP n 1 80 TYR n 1 81 PRO n 1 82 THR n 1 83 LEU n 1 84 LEU n 1 85 GLU n 1 86 LEU n 1 87 SER n 1 88 GLY n 1 89 TYR n 1 90 ILE n 1 91 ALA n 1 92 GLN n 1 93 ILE n 1 94 LEU n 1 95 SER n 1 96 SER n 1 97 GLN n 1 98 GLY n 1 99 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene curA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lyngbya majuscula' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 158786 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pet28a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6DNF2_9CYAN _struct_ref.pdbx_db_accession Q6DNF2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDYPTLLELSGYI AQILSSQGT ; _struct_ref.pdbx_align_begin 1946 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LIW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 11 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 99 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6DNF2 _struct_ref_seq.db_align_beg 1946 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 2034 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1946 _struct_ref_seq.pdbx_auth_seq_align_end 2034 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LIW SER A 1 ? UNP Q6DNF2 ? ? 'EXPRESSION TAG' 1936 1 1 2LIW GLY A 2 ? UNP Q6DNF2 ? ? 'EXPRESSION TAG' 1937 2 1 2LIW LEU A 3 ? UNP Q6DNF2 ? ? 'EXPRESSION TAG' 1938 3 1 2LIW VAL A 4 ? UNP Q6DNF2 ? ? 'EXPRESSION TAG' 1939 4 1 2LIW PRO A 5 ? UNP Q6DNF2 ? ? 'EXPRESSION TAG' 1940 5 1 2LIW ARG A 6 ? UNP Q6DNF2 ? ? 'EXPRESSION TAG' 1941 6 1 2LIW GLY A 7 ? UNP Q6DNF2 ? ? 'EXPRESSION TAG' 1942 7 1 2LIW SER A 8 ? UNP Q6DNF2 ? ? 'EXPRESSION TAG' 1943 8 1 2LIW HIS A 9 ? UNP Q6DNF2 ? ? 'EXPRESSION TAG' 1944 9 1 2LIW MET A 10 ? UNP Q6DNF2 ? ? 'EXPRESSION TAG' 1945 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MAH non-polymer . '3-HYDROXY-3-METHYL-GLUTARIC ACID' ? 'C6 H10 O5' 162.141 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PNS non-polymer . "4'-PHOSPHOPANTETHEINE" ? 'C11 H23 N2 O7 P S' 358.348 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 4 '3D HNCACB' 1 3 4 '3D HNCO' 1 4 4 '3D HNCACO' 1 5 4 '3D H(CCO)NH-TOCSY' 1 6 4 '3D (H)C(CCO)NH-TOCSY' 1 7 2 '3D 1H-13C NOESY' 1 8 1 '3D 1H-15N NOESY' 1 9 4 '(H)CB(CGCC- TOCSY)Har' 1 10 3 'F1-13C/15N-filtered, F3-13C-seperated NOESY-HSQC' 1 11 3 '2D F1/F2-13C/15N double-filtered NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 291 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-98% 15N] Holo ACPI, 5 % D2O, 0.15 mM DSS, 50 mM Glutamate, 50 mM Arginine, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '1 mM [U-13C] Holo ACPI, 5 % D2O, 0.15 mM DSS, 50 mM Arginine, 50 mM Glutamate, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' '1 mM [U-13C] and [U-N15] HMG ACPI, 0.15 mM D2O, 5 % DSS, 50 mM NaCL, 25 mM NaPi, 95% H2O/5% D2O' 3 '95% H2O/5% D2O' '1 mM [U-15N] and (13C) Holo ACPI, 5 % D2O, 0.15 mM DSS, 50 mM Glutamate, 50 mM Arginine, 95% H2O/5% D2O' 4 '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker Avance 1 'Bruker Avance' 600 Bruker Avance 2 'Bruker Avance' 800 Bruker Avance 3 'Bruker Avance' 900 Bruker Avance 4 'Bruker Avance' 950 Bruker Avance 5 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LIW _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LIW _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LIW _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA '2.1 and 3.0' 1 'Guntert, Mumenthaler and Wuthrich' refinement CYANA '2.1 and 3.0' 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LIW _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LIW _struct.title 'NMR structure of HMG-ACPI domain from CurA module from Lyngbya majuscula' _struct.pdbx_descriptor CurA _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LIW _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'PKS, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 18 ? LEU A 34 ? ASN A 1953 LEU A 1969 1 ? 17 HELX_P HELX_P2 2 LYS A 46 ? GLY A 51 ? LYS A 1981 GLY A 1986 1 ? 6 HELX_P HELX_P3 3 ASP A 53 ? ASN A 69 ? ASP A 1988 ASN A 2004 1 ? 17 HELX_P HELX_P4 4 LYS A 73 ? TYR A 80 ? LYS A 2008 TYR A 2015 1 ? 8 HELX_P HELX_P5 5 THR A 82 ? GLY A 98 ? THR A 2017 GLY A 2033 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A SER 54 OG ? ? ? 1_555 B PNS . P24 ? ? A SER 1989 A PNS 2100 1_555 ? ? ? ? ? ? ? 1.598 ? covale2 covale ? ? B PNS . S44 ? ? ? 1_555 C MAH . C1 ? ? A PNS 2100 A MAH 2200 1_555 ? ? ? ? ? ? ? 1.708 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PNS A 2100' AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MAH A 2200' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 SER A 54 ? SER A 1989 . ? 1_555 ? 2 AC1 6 VAL A 58 ? VAL A 1993 . ? 1_555 ? 3 AC1 6 LYS A 73 ? LYS A 2008 . ? 1_555 ? 4 AC1 6 ALA A 74 ? ALA A 2009 . ? 1_555 ? 5 AC1 6 TYR A 78 ? TYR A 2013 . ? 1_555 ? 6 AC1 6 MAH C . ? MAH A 2200 . ? 1_555 ? 7 AC2 1 PNS B . ? PNS A 2100 . ? 1_555 ? # _atom_sites.entry_id 2LIW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1936 1936 SER SER A . n A 1 2 GLY 2 1937 1937 GLY GLY A . n A 1 3 LEU 3 1938 1938 LEU LEU A . n A 1 4 VAL 4 1939 1939 VAL VAL A . n A 1 5 PRO 5 1940 1940 PRO PRO A . n A 1 6 ARG 6 1941 1941 ARG ARG A . n A 1 7 GLY 7 1942 1942 GLY GLY A . n A 1 8 SER 8 1943 1943 SER SER A . n A 1 9 HIS 9 1944 1944 HIS HIS A . n A 1 10 MET 10 1945 1945 MET MET A . n A 1 11 THR 11 1946 1946 THR THR A . n A 1 12 PRO 12 1947 1947 PRO PRO A . n A 1 13 GLN 13 1948 1948 GLN GLN A . n A 1 14 VAL 14 1949 1949 VAL VAL A . n A 1 15 ASN 15 1950 1950 ASN ASN A . n A 1 16 GLN 16 1951 1951 GLN GLN A . n A 1 17 VAL 17 1952 1952 VAL VAL A . n A 1 18 ASN 18 1953 1953 ASN ASN A . n A 1 19 LEU 19 1954 1954 LEU LEU A . n A 1 20 SER 20 1955 1955 SER SER A . n A 1 21 GLU 21 1956 1956 GLU GLU A . n A 1 22 ILE 22 1957 1957 ILE ILE A . n A 1 23 LYS 23 1958 1958 LYS LYS A . n A 1 24 GLN 24 1959 1959 GLN GLN A . n A 1 25 VAL 25 1960 1960 VAL VAL A . n A 1 26 LEU 26 1961 1961 LEU LEU A . n A 1 27 LYS 27 1962 1962 LYS LYS A . n A 1 28 GLN 28 1963 1963 GLN GLN A . n A 1 29 GLN 29 1964 1964 GLN GLN A . n A 1 30 LEU 30 1965 1965 LEU LEU A . n A 1 31 ALA 31 1966 1966 ALA ALA A . n A 1 32 GLU 32 1967 1967 GLU GLU A . n A 1 33 ALA 33 1968 1968 ALA ALA A . n A 1 34 LEU 34 1969 1969 LEU LEU A . n A 1 35 TYR 35 1970 1970 TYR TYR A . n A 1 36 THR 36 1971 1971 THR THR A . n A 1 37 GLU 37 1972 1972 GLU GLU A . n A 1 38 GLU 38 1973 1973 GLU GLU A . n A 1 39 SER 39 1974 1974 SER SER A . n A 1 40 GLU 40 1975 1975 GLU GLU A . n A 1 41 ILE 41 1976 1976 ILE ILE A . n A 1 42 ALA 42 1977 1977 ALA ALA A . n A 1 43 GLU 43 1978 1978 GLU GLU A . n A 1 44 ASP 44 1979 1979 ASP ASP A . n A 1 45 GLN 45 1980 1980 GLN GLN A . n A 1 46 LYS 46 1981 1981 LYS LYS A . n A 1 47 PHE 47 1982 1982 PHE PHE A . n A 1 48 VAL 48 1983 1983 VAL VAL A . n A 1 49 ASP 49 1984 1984 ASP ASP A . n A 1 50 LEU 50 1985 1985 LEU LEU A . n A 1 51 GLY 51 1986 1986 GLY GLY A . n A 1 52 LEU 52 1987 1987 LEU LEU A . n A 1 53 ASP 53 1988 1988 ASP ASP A . n A 1 54 SER 54 1989 1989 SER SRA A . n A 1 55 ILE 55 1990 1990 ILE ILE A . n A 1 56 VAL 56 1991 1991 VAL VAL A . n A 1 57 GLY 57 1992 1992 GLY GLY A . n A 1 58 VAL 58 1993 1993 VAL VAL A . n A 1 59 GLU 59 1994 1994 GLU GLU A . n A 1 60 TRP 60 1995 1995 TRP TRP A . n A 1 61 THR 61 1996 1996 THR THR A . n A 1 62 THR 62 1997 1997 THR THR A . n A 1 63 THR 63 1998 1998 THR THR A . n A 1 64 ILE 64 1999 1999 ILE ILE A . n A 1 65 ASN 65 2000 2000 ASN ASN A . n A 1 66 GLN 66 2001 2001 GLN GLN A . n A 1 67 THR 67 2002 2002 THR THR A . n A 1 68 TYR 68 2003 2003 TYR TYR A . n A 1 69 ASN 69 2004 2004 ASN ASN A . n A 1 70 LEU 70 2005 2005 LEU LEU A . n A 1 71 ASN 71 2006 2006 ASN ASN A . n A 1 72 LEU 72 2007 2007 LEU LEU A . n A 1 73 LYS 73 2008 2008 LYS LYS A . n A 1 74 ALA 74 2009 2009 ALA ALA A . n A 1 75 THR 75 2010 2010 THR THR A . n A 1 76 LYS 76 2011 2011 LYS LYS A . n A 1 77 LEU 77 2012 2012 LEU LEU A . n A 1 78 TYR 78 2013 2013 TYR TYR A . n A 1 79 ASP 79 2014 2014 ASP ASP A . n A 1 80 TYR 80 2015 2015 TYR TYR A . n A 1 81 PRO 81 2016 2016 PRO PRO A . n A 1 82 THR 82 2017 2017 THR THR A . n A 1 83 LEU 83 2018 2018 LEU LEU A . n A 1 84 LEU 84 2019 2019 LEU LEU A . n A 1 85 GLU 85 2020 2020 GLU GLU A . n A 1 86 LEU 86 2021 2021 LEU LEU A . n A 1 87 SER 87 2022 2022 SER SER A . n A 1 88 GLY 88 2023 2023 GLY GLY A . n A 1 89 TYR 89 2024 2024 TYR TYR A . n A 1 90 ILE 90 2025 2025 ILE ILE A . n A 1 91 ALA 91 2026 2026 ALA ALA A . n A 1 92 GLN 92 2027 2027 GLN GLN A . n A 1 93 ILE 93 2028 2028 ILE ILE A . n A 1 94 LEU 94 2029 2029 LEU LEU A . n A 1 95 SER 95 2030 2030 SER SER A . n A 1 96 SER 96 2031 2031 SER SER A . n A 1 97 GLN 97 2032 2032 GLN GLN A . n A 1 98 GLY 98 2033 2033 GLY GLY A . n A 1 99 THR 99 2034 2034 THR THR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PNS 1 2100 1989 PNS SRA A . C 3 MAH 1 2200 1989 MAH SRA A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-12-21 2 'Structure model' 1 1 2012-03-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Holo ACPI-1' 1 ? mM '[U-98% 15N]' 1 D2O-2 5 ? % ? 1 DSS-3 0.15 ? mM ? 1 Glutamate-4 50 ? mM ? 1 Arginine-5 50 ? mM ? 1 'Holo ACPI-6' 1 ? mM '[U-13C]' 2 D2O-7 5 ? % ? 2 DSS-8 0.15 ? mM ? 2 Arginine-9 50 ? mM ? 2 Glutamate-10 50 ? mM ? 2 'HMG ACPI-11' 1 ? mM '[U-13C] and [U-N15]' 3 D2O-12 0.15 ? mM ? 3 DSS-13 5 ? % ? 3 NaCL-14 50 ? mM ? 3 NaPi-15 25 ? mM ? 3 'Holo ACPI-16' 1 ? mM '[U-15N] and (13C)' 4 D2O-17 5 ? % ? 4 DSS-18 0.15 ? mM ? 4 Glutamate-19 50 ? mM ? 4 Arginine-20 50 ? mM ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 2018 ? ? HG A SER 2022 ? ? 1.57 2 1 HG1 A THR 1971 ? ? OE2 A GLU 1975 ? ? 1.59 3 2 HG1 A THR 1971 ? ? OE2 A GLU 1975 ? ? 1.57 4 5 HG1 A THR 1971 ? ? OE2 A GLU 1975 ? ? 1.52 5 7 O A LEU 2018 ? ? HG A SER 2022 ? ? 1.59 6 7 HG1 A THR 1971 ? ? OE2 A GLU 1975 ? ? 1.60 7 9 O A LEU 2018 ? ? HG A SER 2022 ? ? 1.60 8 13 HG1 A THR 1971 ? ? OE2 A GLU 1975 ? ? 1.55 9 14 HG1 A THR 1971 ? ? OE2 A GLU 1975 ? ? 1.56 10 16 O A LEU 2018 ? ? HG A SER 2022 ? ? 1.59 11 19 O A ILE 2028 ? ? HG A SER 2031 ? ? 1.59 12 20 HG1 A THR 1971 ? ? OE1 A GLU 1975 ? ? 1.57 13 20 O A LEU 2018 ? ? HG A SER 2022 ? ? 1.59 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 19 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 TYR _pdbx_validate_rmsd_angle.auth_seq_id_1 2015 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 TYR _pdbx_validate_rmsd_angle.auth_seq_id_2 2015 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 TYR _pdbx_validate_rmsd_angle.auth_seq_id_3 2015 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 116.83 _pdbx_validate_rmsd_angle.angle_target_value 121.00 _pdbx_validate_rmsd_angle.angle_deviation -4.17 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.60 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 1947 ? ? -81.30 -159.19 2 1 LEU A 2005 ? ? -114.33 -169.87 3 2 PRO A 1947 ? ? -79.04 -158.89 4 2 LEU A 2005 ? ? -112.98 -168.66 5 3 PRO A 1940 ? ? -76.45 49.50 6 3 PRO A 1947 ? ? -73.51 -165.55 7 3 LEU A 2005 ? ? -102.96 -168.75 8 4 SER A 1943 ? ? -69.96 -178.21 9 4 PRO A 1947 ? ? -74.35 -167.34 10 4 GLN A 1948 ? ? -67.14 73.61 11 4 LEU A 2005 ? ? -111.62 -168.58 12 5 PRO A 1947 ? ? -76.77 -163.98 13 5 VAL A 1949 ? ? -107.43 78.20 14 5 LEU A 2005 ? ? -108.65 -168.91 15 6 PRO A 1947 ? ? -73.78 -158.89 16 7 SER A 1943 ? ? -151.87 -96.28 17 7 GLN A 1948 ? ? -68.69 88.70 18 7 LEU A 2005 ? ? -116.04 -169.10 19 8 PRO A 1947 ? ? -81.85 -159.45 20 9 LEU A 1938 ? ? -51.50 104.20 21 9 SER A 1943 ? ? -75.23 -164.71 22 9 PRO A 1947 ? ? -75.47 -163.11 23 9 GLN A 1948 ? ? -68.38 85.84 24 10 ARG A 1941 ? ? -142.20 -8.84 25 10 PRO A 1947 ? ? -74.58 -169.80 26 10 VAL A 1952 ? ? -116.07 76.15 27 10 LEU A 2005 ? ? -101.98 -168.98 28 10 PRO A 2016 ? ? -68.63 1.47 29 11 PRO A 1947 ? ? -73.30 -168.31 30 11 LEU A 2005 ? ? -101.46 -168.47 31 12 PRO A 1947 ? ? -74.91 -158.22 32 12 LEU A 2005 ? ? -104.63 -168.82 33 14 PRO A 1947 ? ? -67.52 -172.67 34 15 PRO A 1947 ? ? -67.14 -160.26 35 15 GLN A 1948 ? ? -64.79 65.32 36 15 ASN A 1950 ? ? -68.43 0.55 37 15 LEU A 2005 ? ? -113.81 -168.50 38 16 LEU A 1938 ? ? -69.77 99.96 39 17 THR A 1971 ? ? -124.40 -167.43 40 18 PRO A 1947 ? ? -74.76 -159.68 41 18 LEU A 2005 ? ? -116.05 -169.16 42 19 ARG A 1941 ? ? -146.09 -27.18 43 19 SER A 1943 ? ? -91.01 -62.12 44 19 PRO A 1947 ? ? -73.53 -161.68 45 20 GLN A 1948 ? ? -67.67 99.24 46 20 LEU A 2005 ? ? -109.77 -169.45 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 1970 ? ? 0.074 'SIDE CHAIN' 2 4 TYR A 2015 ? ? 0.083 'SIDE CHAIN' 3 4 TYR A 2024 ? ? 0.087 'SIDE CHAIN' 4 6 TYR A 1970 ? ? 0.073 'SIDE CHAIN' 5 9 TYR A 2024 ? ? 0.078 'SIDE CHAIN' 6 11 TYR A 2015 ? ? 0.104 'SIDE CHAIN' 7 13 TYR A 2024 ? ? 0.086 'SIDE CHAIN' 8 19 TYR A 2015 ? ? 0.097 'SIDE CHAIN' # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "4'-PHOSPHOPANTETHEINE" PNS 3 '3-HYDROXY-3-METHYL-GLUTARIC ACID' MAH #