data_2LJ3 # _entry.id 2LJ3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LJ3 pdb_00002lj3 10.2210/pdb2lj3/pdb RCSB RCSB102443 ? ? BMRB 17915 ? ? WWPDB D_1000102443 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 1SHG PDB 'Crystal Structure of SH3' unspecified 3433 BMRB '1H and 15N assignments and secondary structure of the Src Sh3 domain' unspecified 17915 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LJ3 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2011-09-04 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kumar, D.' 1 'Hosur, R.' 2 # _citation.id primary _citation.title 'PFBD: High-throughput Strategy of Backbone fold Determination for small well-folded proteins in less than a day' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kumar, D.' 1 ? primary 'Hosur, R.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Spectrin alpha chain, brain' _entity.formula_weight 7227.252 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 Domain (UNP RESIDUES 965-1025)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Fodrin alpha chain, Spectrin, non-erythroid alpha chain' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD(NH2)' _entity_poly.pdbx_seq_one_letter_code_can MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 GLU n 1 4 THR n 1 5 GLY n 1 6 LYS n 1 7 GLU n 1 8 LEU n 1 9 VAL n 1 10 LEU n 1 11 ALA n 1 12 LEU n 1 13 TYR n 1 14 ASP n 1 15 TYR n 1 16 GLN n 1 17 GLU n 1 18 LYS n 1 19 SER n 1 20 PRO n 1 21 ARG n 1 22 GLU n 1 23 VAL n 1 24 THR n 1 25 MET n 1 26 LYS n 1 27 LYS n 1 28 GLY n 1 29 ASP n 1 30 ILE n 1 31 LEU n 1 32 THR n 1 33 LEU n 1 34 LEU n 1 35 ASN n 1 36 SER n 1 37 THR n 1 38 ASN n 1 39 LYS n 1 40 ASP n 1 41 TRP n 1 42 TRP n 1 43 LYS n 1 44 VAL n 1 45 GLU n 1 46 VAL n 1 47 ASN n 1 48 ASP n 1 49 ARG n 1 50 GLN n 1 51 GLY n 1 52 PHE n 1 53 VAL n 1 54 PRO n 1 55 ALA n 1 56 ALA n 1 57 TYR n 1 58 VAL n 1 59 LYS n 1 60 LYS n 1 61 LEU n 1 62 ASP n 1 63 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name bantam,chickens _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SPTAN1, SPTA2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pGEX4T1 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SPTA2_CHICK _struct_ref.pdbx_db_accession P07751 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD _struct_ref.pdbx_align_begin 965 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LJ3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 62 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07751 _struct_ref_seq.db_align_beg 965 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1025 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 62 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LJ3 MET A 1 ? UNP P07751 ? ? 'expression tag' 1 1 1 2LJ3 NH2 A 63 ? UNP P07751 ? ? amidation 90 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D hNcnH' 1 2 1 '2D hncNH-G' 1 3 1 '2D hncNH-A' 1 4 1 '2D hncNH-ST' 1 5 1 '2D cbcacoNH' 1 6 1 '2D HnCO' 1 7 1 '2D hnCOcanH' 1 8 1 2D-HncoCA 1 9 1 '2D hncoCAnH' 1 10 1 '2D-(HN)NH-G,A,ST' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.00 mM [U-99% 13C; U-99% 15N] sodium phosphate-1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LJ3 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LJ3 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LJ3 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 1 '3.0 Beta' ? refinement CYANA 2 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'NMR Method Developments' _exptl.entry_id 2LJ3 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LJ3 _struct.title 'PFBD: High-throughput Strategy of Backbone fold Determination for small well-folded proteins in less than a day' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LJ3 _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text 'Chicken SH3 Domain, STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 54 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 56 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 54 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 56 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ASP _struct_conn.ptnr1_label_seq_id 62 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id NH2 _struct_conn.ptnr2_label_seq_id 63 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ASP _struct_conn.ptnr1_auth_seq_id 62 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NH2 _struct_conn.ptnr2_auth_seq_id 90 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.325 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 9 ? ALA A 11 ? VAL A 9 ALA A 11 A 2 VAL A 58 ? LYS A 60 ? VAL A 58 LYS A 60 B 1 LEU A 33 ? ASN A 35 ? LEU A 33 ASN A 35 B 2 LYS A 43 ? GLU A 45 ? LYS A 43 GLU A 45 B 3 GLN A 50 ? PHE A 52 ? GLN A 50 PHE A 52 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 10 ? N LEU A 10 O LYS A 59 ? O LYS A 59 B 1 2 N LEU A 34 ? N LEU A 34 O LYS A 43 ? O LYS A 43 B 2 3 N VAL A 44 ? N VAL A 44 O GLY A 51 ? O GLY A 51 # _atom_sites.entry_id 2LJ3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 NH2 63 90 90 NH2 PL A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-12-07 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_spectrometer 4 2 'Structure model' struct_conn 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' 5 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 2 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_exptl_sample.component 'sodium phosphate-1' _pdbx_nmr_exptl_sample.concentration 1.00 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 O A LEU 61 ? ? N A NH2 90 ? ? 2.07 2 4 HD13 A LEU 10 ? ? N A NH2 90 ? ? 1.46 3 4 CD1 A LEU 10 ? ? N A NH2 90 ? ? 1.99 4 4 CB A LEU 10 ? ? N A NH2 90 ? ? 2.18 5 7 HD21 A LEU 10 ? ? N A NH2 90 ? ? 1.38 6 7 CD2 A LEU 10 ? ? N A NH2 90 ? ? 1.94 7 8 O A LEU 61 ? ? N A NH2 90 ? ? 2.12 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -152.54 28.05 2 1 PRO A 54 ? ? -69.77 89.45 3 2 THR A 4 ? ? -55.40 100.71 4 3 GLU A 3 ? ? -150.24 -67.57 5 3 GLU A 17 ? ? -175.81 -45.49 6 3 THR A 37 ? ? -143.08 29.27 7 3 ASN A 47 ? ? 69.34 -75.67 8 3 ASP A 48 ? ? -151.11 31.26 9 3 PRO A 54 ? ? -69.78 95.23 10 4 ASP A 2 ? ? -59.93 -74.61 11 4 GLU A 3 ? ? -178.78 41.64 12 4 THR A 4 ? ? 64.50 108.85 13 4 TYR A 13 ? ? 178.44 35.13 14 4 TYR A 15 ? ? 63.47 168.75 15 4 GLU A 17 ? ? 63.35 96.21 16 4 LYS A 18 ? ? -179.29 34.41 17 4 GLU A 22 ? ? 63.63 81.79 18 4 SER A 36 ? ? -157.19 86.25 19 4 ASN A 47 ? ? 62.16 62.92 20 4 LEU A 61 ? ? 72.47 -67.72 21 5 GLU A 3 ? ? -174.51 98.82 22 5 THR A 4 ? ? 64.31 92.25 23 5 TYR A 15 ? ? -124.17 -169.47 24 5 GLU A 17 ? ? -156.74 -77.58 25 5 THR A 37 ? ? -109.36 -73.13 26 6 ASP A 2 ? ? -179.10 125.02 27 6 THR A 4 ? ? -160.35 37.15 28 6 GLU A 17 ? ? -63.46 95.78 29 7 GLU A 3 ? ? -166.94 -54.18 30 7 TYR A 13 ? ? -148.32 -42.07 31 7 ASP A 14 ? ? -179.50 127.73 32 7 LYS A 18 ? ? -91.87 45.15 33 7 SER A 36 ? ? -113.55 63.69 34 7 PHE A 52 ? ? -179.22 101.80 35 8 TYR A 15 ? ? -179.40 141.20 36 8 GLU A 17 ? ? -72.12 -168.00 37 8 SER A 19 ? ? -49.87 163.11 38 8 GLU A 22 ? ? 61.06 101.16 39 8 ASN A 35 ? ? -174.36 135.87 40 9 GLU A 3 ? ? -164.13 27.43 41 9 THR A 4 ? ? -163.02 75.66 42 9 ASN A 47 ? ? 69.27 -75.56 43 9 ASP A 48 ? ? -148.12 26.14 44 10 GLU A 3 ? ? -173.72 32.33 45 10 THR A 4 ? ? -177.76 69.92 46 10 TYR A 13 ? ? -175.85 141.91 47 10 TYR A 15 ? ? -166.46 31.31 48 10 GLU A 17 ? ? 63.41 105.59 49 10 LYS A 18 ? ? -175.18 -36.45 50 10 GLU A 22 ? ? 63.59 105.32 51 10 ASN A 47 ? ? 69.33 -75.64 52 10 ASP A 48 ? ? -160.61 26.39 53 11 ASP A 2 ? ? 58.46 -174.69 54 11 THR A 4 ? ? 177.01 75.50 55 11 TYR A 15 ? ? -149.94 31.17 56 11 LYS A 18 ? ? 63.69 69.83 57 11 ASN A 35 ? ? -177.82 149.20 58 11 SER A 36 ? ? -179.25 -63.81 59 11 ASN A 47 ? ? 69.26 -75.63 60 11 ASP A 48 ? ? -161.93 26.09 61 12 GLU A 3 ? ? -176.17 -51.00 62 12 THR A 4 ? ? -168.48 98.58 63 12 TYR A 13 ? ? -177.18 67.63 64 12 TYR A 15 ? ? 63.30 179.82 65 12 GLU A 17 ? ? -103.59 -169.03 66 12 GLU A 22 ? ? 57.06 94.74 67 12 ASP A 48 ? ? 178.40 -64.58 68 13 ASP A 2 ? ? 62.97 170.28 69 13 GLU A 3 ? ? -164.25 84.25 70 13 THR A 4 ? ? 64.51 67.10 71 13 LYS A 18 ? ? -152.17 20.28 72 13 ASN A 35 ? ? -177.69 132.80 73 13 ASN A 47 ? ? 69.29 -75.63 74 13 ASP A 48 ? ? -150.84 30.58 75 14 THR A 4 ? ? 64.36 84.11 76 14 ASP A 14 ? ? -54.56 173.74 77 14 ASN A 47 ? ? 69.29 -75.67 78 14 ASP A 48 ? ? -162.05 26.12 79 15 ASP A 2 ? ? 63.11 162.64 80 15 TYR A 13 ? ? 179.42 54.38 81 15 ASP A 14 ? ? -72.93 -75.19 82 15 TYR A 15 ? ? 179.60 -156.28 83 15 GLU A 17 ? ? -47.87 105.25 84 15 SER A 19 ? ? 178.97 160.08 85 15 GLU A 22 ? ? -126.01 -169.25 86 15 ASN A 35 ? ? -174.33 136.17 87 15 ASN A 47 ? ? 69.20 -75.73 88 15 ASP A 48 ? ? -162.29 26.21 89 16 THR A 4 ? ? -179.92 64.59 90 16 TYR A 13 ? ? 175.10 35.88 91 16 ASP A 14 ? ? -61.01 -77.14 92 16 LYS A 18 ? ? -141.87 24.69 93 16 ASN A 38 ? ? -161.35 -170.00 94 16 ASN A 47 ? ? 69.34 -75.63 95 16 ASP A 48 ? ? -154.68 29.99 96 17 GLU A 3 ? ? -173.82 139.49 97 17 TYR A 13 ? ? -177.74 48.08 98 17 ASP A 14 ? ? 63.57 151.10 99 17 TYR A 15 ? ? -168.88 80.41 100 17 GLU A 17 ? ? 44.49 -162.78 101 17 GLU A 22 ? ? 65.03 152.34 102 18 THR A 4 ? ? -150.91 33.54 103 18 GLU A 7 ? ? 172.96 -61.33 104 18 TYR A 15 ? ? 65.94 -170.92 105 18 GLU A 17 ? ? -63.84 -71.50 106 18 LYS A 18 ? ? -175.36 -44.23 107 18 GLU A 22 ? ? -60.60 -170.02 108 18 ASN A 38 ? ? 64.89 97.44 109 18 ASN A 47 ? ? 69.20 -75.69 110 18 ASP A 48 ? ? -170.41 30.48 111 19 TYR A 13 ? ? -179.59 82.97 112 19 ASP A 14 ? ? -64.72 -71.18 113 19 TYR A 15 ? ? 63.49 -178.76 114 19 GLU A 17 ? ? -63.26 -88.55 115 19 LYS A 18 ? ? 171.66 77.94 116 19 GLU A 22 ? ? -56.00 -179.90 117 19 ASN A 35 ? ? -170.51 124.39 118 19 THR A 37 ? ? -158.17 37.60 119 20 GLU A 3 ? ? -144.99 -43.21 120 20 ASP A 14 ? ? -50.72 105.78 121 20 ASN A 35 ? ? -173.97 124.41 122 20 THR A 37 ? ? -157.68 39.15 123 20 ASN A 47 ? ? 70.56 -70.48 124 20 ASP A 48 ? ? -155.94 22.29 #