data_2LJF # _entry.id 2LJF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LJF pdb_00002ljf 10.2210/pdb2ljf/pdb RCSB RCSB102455 ? ? BMRB 17932 ? 10.13018/BMR17932 WWPDB D_1000102455 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-10-05 2 'Structure model' 1 1 2013-06-19 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' struct_conn 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_entry_details 9 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LJF _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-09-11 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17932 BMRB unspecified . 2LJD PDB unspecified . 2LJE PDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Deshmukh, L.' 1 'Vinogradova, O.' 2 # _citation.id primary _citation.title 'Tyrosine phosphorylation as a conformational switch: a case study of integrin Beta3 cytoplasmic tail.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 286 _citation.page_first 40943 _citation.page_last 40953 _citation.year 2011 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21956114 _citation.pdbx_database_id_DOI 10.1074/jbc.M111.231951 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Deshmukh, L.' 1 ? primary 'Meller, N.' 2 ? primary 'Alder, N.' 3 ? primary 'Byzova, T.' 4 ? primary 'Vinogradova, O.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Integrin beta-3' _entity.formula_weight 7837.619 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Cytoplasmic domain residues 742-788' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Platelet membrane glycoprotein IIIa, GPIIIa' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'GSSHHHHHHSSGLVPRGSHMKLLITIHDRKEFAKFEEERARAKWDTANNPL(PTR)KEATSTFTNITYRGT' _entity_poly.pdbx_seq_one_letter_code_can GSSHHHHHHSSGLVPRGSHMKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 SER n 1 11 SER n 1 12 GLY n 1 13 LEU n 1 14 VAL n 1 15 PRO n 1 16 ARG n 1 17 GLY n 1 18 SER n 1 19 HIS n 1 20 MET n 1 21 LYS n 1 22 LEU n 1 23 LEU n 1 24 ILE n 1 25 THR n 1 26 ILE n 1 27 HIS n 1 28 ASP n 1 29 ARG n 1 30 LYS n 1 31 GLU n 1 32 PHE n 1 33 ALA n 1 34 LYS n 1 35 PHE n 1 36 GLU n 1 37 GLU n 1 38 GLU n 1 39 ARG n 1 40 ALA n 1 41 ARG n 1 42 ALA n 1 43 LYS n 1 44 TRP n 1 45 ASP n 1 46 THR n 1 47 ALA n 1 48 ASN n 1 49 ASN n 1 50 PRO n 1 51 LEU n 1 52 PTR n 1 53 LYS n 1 54 GLU n 1 55 ALA n 1 56 THR n 1 57 SER n 1 58 THR n 1 59 PHE n 1 60 THR n 1 61 ASN n 1 62 ILE n 1 63 THR n 1 64 TYR n 1 65 ARG n 1 66 GLY n 1 67 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ITGB3, GP3A' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET15b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 696 ? ? ? A . n A 1 2 SER 2 697 ? ? ? A . n A 1 3 SER 3 698 ? ? ? A . n A 1 4 HIS 4 699 ? ? ? A . n A 1 5 HIS 5 700 ? ? ? A . n A 1 6 HIS 6 701 ? ? ? A . n A 1 7 HIS 7 702 ? ? ? A . n A 1 8 HIS 8 703 ? ? ? A . n A 1 9 HIS 9 704 ? ? ? A . n A 1 10 SER 10 705 ? ? ? A . n A 1 11 SER 11 706 ? ? ? A . n A 1 12 GLY 12 707 ? ? ? A . n A 1 13 LEU 13 708 ? ? ? A . n A 1 14 VAL 14 709 ? ? ? A . n A 1 15 PRO 15 710 ? ? ? A . n A 1 16 ARG 16 711 ? ? ? A . n A 1 17 GLY 17 712 ? ? ? A . n A 1 18 SER 18 713 ? ? ? A . n A 1 19 HIS 19 714 ? ? ? A . n A 1 20 MET 20 715 ? ? ? A . n A 1 21 LYS 21 716 716 LYS LYS A . n A 1 22 LEU 22 717 717 LEU LEU A . n A 1 23 LEU 23 718 718 LEU LEU A . n A 1 24 ILE 24 719 719 ILE ILE A . n A 1 25 THR 25 720 720 THR THR A . n A 1 26 ILE 26 721 721 ILE ILE A . n A 1 27 HIS 27 722 722 HIS HIS A . n A 1 28 ASP 28 723 723 ASP ASP A . n A 1 29 ARG 29 724 724 ARG ARG A . n A 1 30 LYS 30 725 725 LYS LYS A . n A 1 31 GLU 31 726 726 GLU GLU A . n A 1 32 PHE 32 727 727 PHE PHE A . n A 1 33 ALA 33 728 728 ALA ALA A . n A 1 34 LYS 34 729 729 LYS LYS A . n A 1 35 PHE 35 730 730 PHE PHE A . n A 1 36 GLU 36 731 731 GLU GLU A . n A 1 37 GLU 37 732 732 GLU GLU A . n A 1 38 GLU 38 733 733 GLU GLU A . n A 1 39 ARG 39 734 734 ARG ARG A . n A 1 40 ALA 40 735 735 ALA ALA A . n A 1 41 ARG 41 736 736 ARG ARG A . n A 1 42 ALA 42 737 737 ALA ALA A . n A 1 43 LYS 43 738 738 LYS LYS A . n A 1 44 TRP 44 739 739 TRP TRP A . n A 1 45 ASP 45 740 740 ASP ASP A . n A 1 46 THR 46 741 741 THR THR A . n A 1 47 ALA 47 742 742 ALA ALA A . n A 1 48 ASN 48 743 743 ASN ASN A . n A 1 49 ASN 49 744 744 ASN ASN A . n A 1 50 PRO 50 745 745 PRO PRO A . n A 1 51 LEU 51 746 746 LEU LEU A . n A 1 52 PTR 52 747 747 PTR PTR A . n A 1 53 LYS 53 748 748 LYS LYS A . n A 1 54 GLU 54 749 749 GLU GLU A . n A 1 55 ALA 55 750 750 ALA ALA A . n A 1 56 THR 56 751 751 THR THR A . n A 1 57 SER 57 752 752 SER SER A . n A 1 58 THR 58 753 753 THR THR A . n A 1 59 PHE 59 754 754 PHE PHE A . n A 1 60 THR 60 755 755 THR THR A . n A 1 61 ASN 61 756 756 ASN ASN A . n A 1 62 ILE 62 757 757 ILE ILE A . n A 1 63 THR 63 758 758 THR THR A . n A 1 64 TYR 64 759 759 TYR TYR A . n A 1 65 ARG 65 760 760 ARG ARG A . n A 1 66 GLY 66 761 761 GLY GLY A . n A 1 67 THR 67 762 762 THR THR A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LJF _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LJF _struct.title 'Monophosphorylated (747pY) beta3 integrin cytoplasmic tail under aqueous conditions' _struct.pdbx_model_details 'closest to the average, model 6' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LJF _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN, CELL ADHESION' _struct_keywords.text 'cell adhesion, tyrosine phosphorylation, MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ITB3_HUMAN _struct_ref.pdbx_db_accession P05106 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT _struct_ref.pdbx_align_begin 742 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LJF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P05106 _struct_ref_seq.db_align_beg 742 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 788 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 716 _struct_ref_seq.pdbx_auth_seq_align_end 762 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LJF GLY A 1 ? UNP P05106 ? ? 'expression tag' 696 1 1 2LJF SER A 2 ? UNP P05106 ? ? 'expression tag' 697 2 1 2LJF SER A 3 ? UNP P05106 ? ? 'expression tag' 698 3 1 2LJF HIS A 4 ? UNP P05106 ? ? 'expression tag' 699 4 1 2LJF HIS A 5 ? UNP P05106 ? ? 'expression tag' 700 5 1 2LJF HIS A 6 ? UNP P05106 ? ? 'expression tag' 701 6 1 2LJF HIS A 7 ? UNP P05106 ? ? 'expression tag' 702 7 1 2LJF HIS A 8 ? UNP P05106 ? ? 'expression tag' 703 8 1 2LJF HIS A 9 ? UNP P05106 ? ? 'expression tag' 704 9 1 2LJF SER A 10 ? UNP P05106 ? ? 'expression tag' 705 10 1 2LJF SER A 11 ? UNP P05106 ? ? 'expression tag' 706 11 1 2LJF GLY A 12 ? UNP P05106 ? ? 'expression tag' 707 12 1 2LJF LEU A 13 ? UNP P05106 ? ? 'expression tag' 708 13 1 2LJF VAL A 14 ? UNP P05106 ? ? 'expression tag' 709 14 1 2LJF PRO A 15 ? UNP P05106 ? ? 'expression tag' 710 15 1 2LJF ARG A 16 ? UNP P05106 ? ? 'expression tag' 711 16 1 2LJF GLY A 17 ? UNP P05106 ? ? 'expression tag' 712 17 1 2LJF SER A 18 ? UNP P05106 ? ? 'expression tag' 713 18 1 2LJF HIS A 19 ? UNP P05106 ? ? 'expression tag' 714 19 1 2LJF MET A 20 ? UNP P05106 ? ? 'expression tag' 715 20 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ILE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 26 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 31 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ILE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 721 _struct_conf.end_auth_comp_id GLU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 726 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 51 C ? ? ? 1_555 A PTR 52 N ? ? A LEU 746 A PTR 747 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale2 covale both ? A PTR 52 C ? ? ? 1_555 A LYS 53 N ? ? A PTR 747 A LYS 748 1_555 ? ? ? ? ? ? ? 1.297 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id PTR _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 52 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id PTR _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 747 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id TYR _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id PTR _pdbx_modification_feature.type Phosphorylation _pdbx_modification_feature.category 'Named protein modification' # _pdbx_entry_details.entry_id 2LJF _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD22 A ASN 744 ? ? HA A PTR 747 ? ? 1.22 2 1 HB3 A GLU 733 ? ? HA A ARG 736 ? ? 1.34 3 1 HZ3 A LYS 738 ? ? O3P A PTR 747 ? ? 1.53 4 2 HD22 A ASN 744 ? ? HA A PTR 747 ? ? 1.27 5 3 HB3 A GLU 733 ? ? HA A ARG 736 ? ? 1.18 6 3 HE1 A TYR 759 ? ? HB A THR 762 ? ? 1.24 7 3 HZ A PHE 727 ? ? HA A ASP 740 ? ? 1.33 8 3 HZ3 A LYS 738 ? ? O1P A PTR 747 ? ? 1.58 9 4 HD22 A ASN 744 ? ? HA A PTR 747 ? ? 1.29 10 4 HB2 A ASN 744 ? ? HD2 A PRO 745 ? ? 1.35 11 4 HZ2 A LYS 738 ? ? O3P A PTR 747 ? ? 1.49 12 5 HZ A PHE 727 ? ? HA A ASP 740 ? ? 1.16 13 6 HZ3 A LYS 738 ? ? O2P A PTR 747 ? ? 1.48 14 7 HD22 A ASN 744 ? ? HA A PTR 747 ? ? 1.26 15 7 HB2 A ASN 744 ? ? HD2 A PRO 745 ? ? 1.34 16 7 HZ1 A LYS 738 ? ? O3P A PTR 747 ? ? 1.49 17 8 HB3 A GLU 733 ? ? HA A ARG 736 ? ? 1.12 18 10 HB2 A ASN 744 ? ? HD2 A PRO 745 ? ? 1.32 19 10 HD22 A ASN 744 ? ? HA A PTR 747 ? ? 1.32 20 10 HZ3 A LYS 738 ? ? O2P A PTR 747 ? ? 1.44 21 11 HZ3 A LYS 738 ? ? O1P A PTR 747 ? ? 1.54 22 12 HB2 A ASN 744 ? ? HD2 A PRO 745 ? ? 1.33 23 13 HB2 A ASN 744 ? ? HD2 A PRO 745 ? ? 1.34 24 14 HB3 A GLU 733 ? ? HA A ARG 736 ? ? 1.29 25 14 HG2 A ARG 736 ? ? HG21 A THR 753 ? ? 1.34 26 14 HZ2 A LYS 738 ? ? O3P A PTR 747 ? ? 1.58 27 15 HZ3 A LYS 738 ? ? O3P A PTR 747 ? ? 1.50 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 717 ? ? -88.44 -74.77 2 1 LEU A 718 ? ? -126.02 -60.34 3 1 ILE A 721 ? ? -132.73 -61.78 4 1 GLU A 732 ? ? -92.33 -87.79 5 1 GLU A 733 ? ? 62.34 89.68 6 1 ARG A 736 ? ? 63.83 69.19 7 1 ALA A 737 ? ? 70.53 -45.31 8 1 LYS A 738 ? ? 25.55 -78.90 9 1 ASN A 743 ? ? -127.85 -70.58 10 1 LEU A 746 ? ? -116.68 -81.74 11 1 PTR A 747 ? ? -173.94 26.10 12 1 GLU A 749 ? ? -86.77 -74.52 13 2 LEU A 717 ? ? -96.41 -83.73 14 2 LEU A 718 ? ? -138.08 -46.20 15 2 ILE A 721 ? ? -131.71 -45.35 16 2 GLU A 732 ? ? -84.50 -83.93 17 2 GLU A 733 ? ? 57.82 84.68 18 2 ARG A 736 ? ? 58.05 73.07 19 2 ASP A 740 ? ? 65.97 114.21 20 2 ALA A 742 ? ? -157.24 -22.42 21 2 ASN A 743 ? ? -96.67 -75.78 22 2 LEU A 746 ? ? -105.38 -80.68 23 2 PTR A 747 ? ? 173.80 92.43 24 2 LYS A 748 ? ? -130.42 -31.15 25 3 LEU A 717 ? ? -80.96 -73.74 26 3 LEU A 718 ? ? -137.52 -66.10 27 3 ILE A 721 ? ? -134.74 -30.99 28 3 HIS A 722 ? ? -141.05 28.24 29 3 GLU A 732 ? ? -87.33 -93.85 30 3 GLU A 733 ? ? 52.57 85.81 31 3 ARG A 736 ? ? 64.52 75.86 32 3 ASN A 743 ? ? -121.83 -64.26 33 3 LEU A 746 ? ? -145.19 -82.82 34 3 PTR A 747 ? ? 178.80 82.97 35 3 TYR A 759 ? ? -100.44 -67.45 36 4 LEU A 717 ? ? -86.54 -79.80 37 4 LEU A 718 ? ? -126.38 -63.66 38 4 ILE A 721 ? ? -140.06 -42.21 39 4 GLU A 732 ? ? -90.25 -87.57 40 4 GLU A 733 ? ? 64.67 97.72 41 4 ARG A 736 ? ? 62.52 71.11 42 4 ASP A 740 ? ? 47.17 73.28 43 4 ALA A 742 ? ? -147.69 -28.61 44 4 LEU A 746 ? ? -109.98 -76.97 45 4 PTR A 747 ? ? 176.23 88.81 46 4 GLU A 749 ? ? -112.25 -78.00 47 4 TYR A 759 ? ? -122.73 -58.36 48 4 ARG A 760 ? ? -145.23 -29.40 49 5 LEU A 717 ? ? -77.88 -79.03 50 5 LEU A 718 ? ? -131.63 -62.87 51 5 ILE A 721 ? ? -133.17 -58.59 52 5 GLU A 732 ? ? -76.01 -86.06 53 5 GLU A 733 ? ? 45.95 86.51 54 5 ARG A 736 ? ? 60.71 86.22 55 5 ASN A 743 ? ? -131.53 -67.88 56 5 LEU A 746 ? ? -136.02 -86.31 57 5 PTR A 747 ? ? -179.45 88.94 58 5 GLU A 749 ? ? -146.81 -50.74 59 5 ALA A 750 ? ? -162.09 105.46 60 5 THR A 753 ? ? 179.34 128.31 61 5 THR A 755 ? ? 47.33 88.57 62 5 ASN A 756 ? ? -162.39 -45.55 63 5 TYR A 759 ? ? -64.72 -84.33 64 6 LEU A 717 ? ? -77.19 -82.29 65 6 LEU A 718 ? ? -123.43 -77.81 66 6 ILE A 721 ? ? -147.59 -50.24 67 6 GLU A 732 ? ? -92.00 -79.68 68 6 GLU A 733 ? ? 59.39 83.19 69 6 ALA A 735 ? ? -143.83 13.62 70 6 ARG A 736 ? ? 68.67 62.66 71 6 ALA A 737 ? ? 52.92 17.13 72 6 ASP A 740 ? ? 54.18 84.83 73 6 ASN A 743 ? ? -123.05 -69.11 74 6 LEU A 746 ? ? -124.27 -74.64 75 6 PTR A 747 ? ? 177.15 87.60 76 6 GLU A 749 ? ? -145.59 -47.07 77 7 LEU A 717 ? ? -89.28 -83.31 78 7 LEU A 718 ? ? -120.55 -71.24 79 7 GLU A 732 ? ? -91.04 -85.18 80 7 GLU A 733 ? ? 61.22 88.13 81 7 ASP A 740 ? ? 65.67 115.68 82 7 LEU A 746 ? ? -119.88 -78.19 83 7 PTR A 747 ? ? -179.42 91.55 84 7 LYS A 748 ? ? -146.93 15.79 85 7 GLU A 749 ? ? -151.35 -49.19 86 7 THR A 753 ? ? -173.76 122.28 87 7 TYR A 759 ? ? -154.44 -40.99 88 8 LEU A 717 ? ? -136.67 -62.37 89 8 LEU A 718 ? ? -135.49 -51.63 90 8 ILE A 721 ? ? -136.26 -49.63 91 8 GLU A 732 ? ? -92.65 -88.13 92 8 GLU A 733 ? ? 62.89 95.60 93 8 ARG A 736 ? ? 61.08 74.06 94 8 ALA A 737 ? ? 68.90 -41.70 95 8 LYS A 738 ? ? 7.74 -70.71 96 8 ASN A 743 ? ? -122.27 -53.58 97 8 LEU A 746 ? ? -120.76 -77.78 98 8 PTR A 747 ? ? 162.91 6.17 99 8 PHE A 754 ? ? -147.59 -28.68 100 8 ARG A 760 ? ? -131.56 -54.87 101 9 LEU A 718 ? ? -124.93 -54.82 102 9 ILE A 721 ? ? -133.31 -42.80 103 9 GLU A 732 ? ? -92.23 -90.60 104 9 GLU A 733 ? ? 68.76 105.98 105 9 LEU A 746 ? ? -123.45 -63.43 106 9 PTR A 747 ? ? 176.24 74.91 107 9 GLU A 749 ? ? -103.02 -63.92 108 9 ALA A 750 ? ? -161.88 -167.43 109 9 PHE A 754 ? ? -136.09 -51.25 110 9 TYR A 759 ? ? -82.83 -74.87 111 10 LEU A 717 ? ? -95.67 -72.32 112 10 LEU A 718 ? ? -131.32 -65.23 113 10 ILE A 721 ? ? -132.65 -41.61 114 10 GLU A 732 ? ? -112.72 -85.82 115 10 GLU A 733 ? ? 61.28 92.06 116 10 ARG A 736 ? ? 58.91 72.58 117 10 ASN A 743 ? ? -125.06 -56.94 118 10 LEU A 746 ? ? -124.62 -85.40 119 10 PTR A 747 ? ? -170.14 78.68 120 10 GLU A 749 ? ? -99.29 -73.23 121 10 THR A 753 ? ? -176.87 138.29 122 10 THR A 758 ? ? -94.54 36.29 123 10 ARG A 760 ? ? -124.22 -63.55 124 11 LEU A 717 ? ? -74.74 -78.59 125 11 LEU A 718 ? ? -114.24 -74.75 126 11 GLU A 732 ? ? -98.38 -87.94 127 11 GLU A 733 ? ? 60.28 88.58 128 11 ARG A 736 ? ? 66.62 66.89 129 11 ASP A 740 ? ? 72.46 112.88 130 11 ALA A 742 ? ? -160.81 27.65 131 11 LEU A 746 ? ? -139.12 -82.28 132 11 PTR A 747 ? ? 178.19 89.09 133 11 GLU A 749 ? ? -108.59 -74.85 134 11 THR A 753 ? ? -176.53 132.42 135 12 LEU A 717 ? ? -81.43 -76.95 136 12 LEU A 718 ? ? -128.02 -60.61 137 12 ILE A 721 ? ? -134.81 -44.03 138 12 GLU A 732 ? ? -90.06 -89.04 139 12 GLU A 733 ? ? 62.21 87.05 140 12 ASN A 743 ? ? -120.36 -74.97 141 12 LEU A 746 ? ? -120.18 -67.88 142 12 PTR A 747 ? ? 172.13 76.67 143 12 GLU A 749 ? ? -91.78 -61.54 144 12 THR A 753 ? ? -173.06 145.13 145 12 PHE A 754 ? ? -136.10 -41.13 146 12 TYR A 759 ? ? -137.66 -55.75 147 12 ARG A 760 ? ? -131.68 -48.16 148 13 LEU A 717 ? ? -94.35 -64.62 149 13 LEU A 718 ? ? -94.02 -71.50 150 13 GLU A 732 ? ? -93.51 -92.26 151 13 GLU A 733 ? ? 65.82 98.96 152 13 ARG A 736 ? ? 69.62 62.95 153 13 ASN A 743 ? ? -129.17 -58.99 154 13 LEU A 746 ? ? -125.24 -79.55 155 13 PTR A 747 ? ? 170.34 84.13 156 13 GLU A 749 ? ? -98.45 -77.12 157 13 TYR A 759 ? ? -128.00 -81.55 158 14 LEU A 718 ? ? -122.09 -58.00 159 14 ILE A 721 ? ? -141.49 -49.77 160 14 GLU A 732 ? ? -99.34 -94.42 161 14 GLU A 733 ? ? 50.12 83.14 162 14 ARG A 736 ? ? 53.98 78.17 163 14 ASP A 740 ? ? 69.57 117.72 164 14 ALA A 742 ? ? -153.91 -29.38 165 14 ASN A 743 ? ? -98.40 -66.57 166 14 LEU A 746 ? ? -139.81 -81.64 167 14 PTR A 747 ? ? 179.34 87.74 168 14 GLU A 749 ? ? -120.45 -77.12 169 14 TYR A 759 ? ? -65.71 -89.48 170 15 LEU A 717 ? ? -127.15 -75.26 171 15 LEU A 718 ? ? -145.81 -53.22 172 15 ILE A 721 ? ? -139.02 -56.52 173 15 GLU A 732 ? ? -102.10 -88.30 174 15 GLU A 733 ? ? 61.28 95.75 175 15 ARG A 736 ? ? 60.70 73.55 176 15 ASP A 740 ? ? 64.90 116.99 177 15 ALA A 742 ? ? -167.29 33.65 178 15 LEU A 746 ? ? -139.73 -77.93 179 15 PTR A 747 ? ? 168.52 93.31 180 15 ARG A 760 ? ? -126.55 -62.95 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 52 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 747 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details O-PHOSPHOTYROSINE # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LJF _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LJF _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.contents '0.4 mM [U-100% 15N] protein, 1 mM DSS, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 0.4 ? mM '[U-100% 15N]' 1 DSS-2 1 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 5.9 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-1H NOESY' 1 3 1 '3D 1H-15N NOESY' # _pdbx_nmr_refine.entry_id 2LJF _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details 'refinement in explicit water' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.21 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 'Bhattacharya and Montelione' validation PSVS ? 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 696 ? A GLY 1 2 1 Y 1 A SER 697 ? A SER 2 3 1 Y 1 A SER 698 ? A SER 3 4 1 Y 1 A HIS 699 ? A HIS 4 5 1 Y 1 A HIS 700 ? A HIS 5 6 1 Y 1 A HIS 701 ? A HIS 6 7 1 Y 1 A HIS 702 ? A HIS 7 8 1 Y 1 A HIS 703 ? A HIS 8 9 1 Y 1 A HIS 704 ? A HIS 9 10 1 Y 1 A SER 705 ? A SER 10 11 1 Y 1 A SER 706 ? A SER 11 12 1 Y 1 A GLY 707 ? A GLY 12 13 1 Y 1 A LEU 708 ? A LEU 13 14 1 Y 1 A VAL 709 ? A VAL 14 15 1 Y 1 A PRO 710 ? A PRO 15 16 1 Y 1 A ARG 711 ? A ARG 16 17 1 Y 1 A GLY 712 ? A GLY 17 18 1 Y 1 A SER 713 ? A SER 18 19 1 Y 1 A HIS 714 ? A HIS 19 20 1 Y 1 A MET 715 ? A MET 20 21 2 Y 1 A GLY 696 ? A GLY 1 22 2 Y 1 A SER 697 ? A SER 2 23 2 Y 1 A SER 698 ? A SER 3 24 2 Y 1 A HIS 699 ? A HIS 4 25 2 Y 1 A HIS 700 ? A HIS 5 26 2 Y 1 A HIS 701 ? A HIS 6 27 2 Y 1 A HIS 702 ? A HIS 7 28 2 Y 1 A HIS 703 ? A HIS 8 29 2 Y 1 A HIS 704 ? A HIS 9 30 2 Y 1 A SER 705 ? A SER 10 31 2 Y 1 A SER 706 ? A SER 11 32 2 Y 1 A GLY 707 ? A GLY 12 33 2 Y 1 A LEU 708 ? A LEU 13 34 2 Y 1 A VAL 709 ? A VAL 14 35 2 Y 1 A PRO 710 ? A PRO 15 36 2 Y 1 A ARG 711 ? A ARG 16 37 2 Y 1 A GLY 712 ? A GLY 17 38 2 Y 1 A SER 713 ? A SER 18 39 2 Y 1 A HIS 714 ? A HIS 19 40 2 Y 1 A MET 715 ? A MET 20 41 3 Y 1 A GLY 696 ? A GLY 1 42 3 Y 1 A SER 697 ? A SER 2 43 3 Y 1 A SER 698 ? A SER 3 44 3 Y 1 A HIS 699 ? A HIS 4 45 3 Y 1 A HIS 700 ? A HIS 5 46 3 Y 1 A HIS 701 ? A HIS 6 47 3 Y 1 A HIS 702 ? A HIS 7 48 3 Y 1 A HIS 703 ? A HIS 8 49 3 Y 1 A HIS 704 ? A HIS 9 50 3 Y 1 A SER 705 ? A SER 10 51 3 Y 1 A SER 706 ? A SER 11 52 3 Y 1 A GLY 707 ? A GLY 12 53 3 Y 1 A LEU 708 ? A LEU 13 54 3 Y 1 A VAL 709 ? A VAL 14 55 3 Y 1 A PRO 710 ? A PRO 15 56 3 Y 1 A ARG 711 ? A ARG 16 57 3 Y 1 A GLY 712 ? A GLY 17 58 3 Y 1 A SER 713 ? A SER 18 59 3 Y 1 A HIS 714 ? A HIS 19 60 3 Y 1 A MET 715 ? A MET 20 61 4 Y 1 A GLY 696 ? A GLY 1 62 4 Y 1 A SER 697 ? A SER 2 63 4 Y 1 A SER 698 ? A SER 3 64 4 Y 1 A HIS 699 ? A HIS 4 65 4 Y 1 A HIS 700 ? A HIS 5 66 4 Y 1 A HIS 701 ? A HIS 6 67 4 Y 1 A HIS 702 ? A HIS 7 68 4 Y 1 A HIS 703 ? A HIS 8 69 4 Y 1 A HIS 704 ? A HIS 9 70 4 Y 1 A SER 705 ? A SER 10 71 4 Y 1 A SER 706 ? A SER 11 72 4 Y 1 A GLY 707 ? A GLY 12 73 4 Y 1 A LEU 708 ? A LEU 13 74 4 Y 1 A VAL 709 ? A VAL 14 75 4 Y 1 A PRO 710 ? A PRO 15 76 4 Y 1 A ARG 711 ? A ARG 16 77 4 Y 1 A GLY 712 ? A GLY 17 78 4 Y 1 A SER 713 ? A SER 18 79 4 Y 1 A HIS 714 ? A HIS 19 80 4 Y 1 A MET 715 ? A MET 20 81 5 Y 1 A GLY 696 ? A GLY 1 82 5 Y 1 A SER 697 ? A SER 2 83 5 Y 1 A SER 698 ? A SER 3 84 5 Y 1 A HIS 699 ? A HIS 4 85 5 Y 1 A HIS 700 ? A HIS 5 86 5 Y 1 A HIS 701 ? A HIS 6 87 5 Y 1 A HIS 702 ? A HIS 7 88 5 Y 1 A HIS 703 ? A HIS 8 89 5 Y 1 A HIS 704 ? A HIS 9 90 5 Y 1 A SER 705 ? A SER 10 91 5 Y 1 A SER 706 ? A SER 11 92 5 Y 1 A GLY 707 ? A GLY 12 93 5 Y 1 A LEU 708 ? A LEU 13 94 5 Y 1 A VAL 709 ? A VAL 14 95 5 Y 1 A PRO 710 ? A PRO 15 96 5 Y 1 A ARG 711 ? A ARG 16 97 5 Y 1 A GLY 712 ? A GLY 17 98 5 Y 1 A SER 713 ? A SER 18 99 5 Y 1 A HIS 714 ? A HIS 19 100 5 Y 1 A MET 715 ? A MET 20 101 6 Y 1 A GLY 696 ? A GLY 1 102 6 Y 1 A SER 697 ? A SER 2 103 6 Y 1 A SER 698 ? A SER 3 104 6 Y 1 A HIS 699 ? A HIS 4 105 6 Y 1 A HIS 700 ? A HIS 5 106 6 Y 1 A HIS 701 ? A HIS 6 107 6 Y 1 A HIS 702 ? A HIS 7 108 6 Y 1 A HIS 703 ? A HIS 8 109 6 Y 1 A HIS 704 ? A HIS 9 110 6 Y 1 A SER 705 ? A SER 10 111 6 Y 1 A SER 706 ? A SER 11 112 6 Y 1 A GLY 707 ? A GLY 12 113 6 Y 1 A LEU 708 ? A LEU 13 114 6 Y 1 A VAL 709 ? A VAL 14 115 6 Y 1 A PRO 710 ? A PRO 15 116 6 Y 1 A ARG 711 ? A ARG 16 117 6 Y 1 A GLY 712 ? A GLY 17 118 6 Y 1 A SER 713 ? A SER 18 119 6 Y 1 A HIS 714 ? A HIS 19 120 6 Y 1 A MET 715 ? A MET 20 121 7 Y 1 A GLY 696 ? A GLY 1 122 7 Y 1 A SER 697 ? A SER 2 123 7 Y 1 A SER 698 ? A SER 3 124 7 Y 1 A HIS 699 ? A HIS 4 125 7 Y 1 A HIS 700 ? A HIS 5 126 7 Y 1 A HIS 701 ? A HIS 6 127 7 Y 1 A HIS 702 ? A HIS 7 128 7 Y 1 A HIS 703 ? A HIS 8 129 7 Y 1 A HIS 704 ? A HIS 9 130 7 Y 1 A SER 705 ? A SER 10 131 7 Y 1 A SER 706 ? A SER 11 132 7 Y 1 A GLY 707 ? A GLY 12 133 7 Y 1 A LEU 708 ? A LEU 13 134 7 Y 1 A VAL 709 ? A VAL 14 135 7 Y 1 A PRO 710 ? A PRO 15 136 7 Y 1 A ARG 711 ? A ARG 16 137 7 Y 1 A GLY 712 ? A GLY 17 138 7 Y 1 A SER 713 ? A SER 18 139 7 Y 1 A HIS 714 ? A HIS 19 140 7 Y 1 A MET 715 ? A MET 20 141 8 Y 1 A GLY 696 ? A GLY 1 142 8 Y 1 A SER 697 ? A SER 2 143 8 Y 1 A SER 698 ? A SER 3 144 8 Y 1 A HIS 699 ? A HIS 4 145 8 Y 1 A HIS 700 ? A HIS 5 146 8 Y 1 A HIS 701 ? A HIS 6 147 8 Y 1 A HIS 702 ? A HIS 7 148 8 Y 1 A HIS 703 ? A HIS 8 149 8 Y 1 A HIS 704 ? A HIS 9 150 8 Y 1 A SER 705 ? A SER 10 151 8 Y 1 A SER 706 ? A SER 11 152 8 Y 1 A GLY 707 ? A GLY 12 153 8 Y 1 A LEU 708 ? A LEU 13 154 8 Y 1 A VAL 709 ? A VAL 14 155 8 Y 1 A PRO 710 ? A PRO 15 156 8 Y 1 A ARG 711 ? A ARG 16 157 8 Y 1 A GLY 712 ? A GLY 17 158 8 Y 1 A SER 713 ? A SER 18 159 8 Y 1 A HIS 714 ? A HIS 19 160 8 Y 1 A MET 715 ? A MET 20 161 9 Y 1 A GLY 696 ? A GLY 1 162 9 Y 1 A SER 697 ? A SER 2 163 9 Y 1 A SER 698 ? A SER 3 164 9 Y 1 A HIS 699 ? A HIS 4 165 9 Y 1 A HIS 700 ? A HIS 5 166 9 Y 1 A HIS 701 ? A HIS 6 167 9 Y 1 A HIS 702 ? A HIS 7 168 9 Y 1 A HIS 703 ? A HIS 8 169 9 Y 1 A HIS 704 ? A HIS 9 170 9 Y 1 A SER 705 ? A SER 10 171 9 Y 1 A SER 706 ? A SER 11 172 9 Y 1 A GLY 707 ? A GLY 12 173 9 Y 1 A LEU 708 ? A LEU 13 174 9 Y 1 A VAL 709 ? A VAL 14 175 9 Y 1 A PRO 710 ? A PRO 15 176 9 Y 1 A ARG 711 ? A ARG 16 177 9 Y 1 A GLY 712 ? A GLY 17 178 9 Y 1 A SER 713 ? A SER 18 179 9 Y 1 A HIS 714 ? A HIS 19 180 9 Y 1 A MET 715 ? A MET 20 181 10 Y 1 A GLY 696 ? A GLY 1 182 10 Y 1 A SER 697 ? A SER 2 183 10 Y 1 A SER 698 ? A SER 3 184 10 Y 1 A HIS 699 ? A HIS 4 185 10 Y 1 A HIS 700 ? A HIS 5 186 10 Y 1 A HIS 701 ? A HIS 6 187 10 Y 1 A HIS 702 ? A HIS 7 188 10 Y 1 A HIS 703 ? A HIS 8 189 10 Y 1 A HIS 704 ? A HIS 9 190 10 Y 1 A SER 705 ? A SER 10 191 10 Y 1 A SER 706 ? A SER 11 192 10 Y 1 A GLY 707 ? A GLY 12 193 10 Y 1 A LEU 708 ? A LEU 13 194 10 Y 1 A VAL 709 ? A VAL 14 195 10 Y 1 A PRO 710 ? A PRO 15 196 10 Y 1 A ARG 711 ? A ARG 16 197 10 Y 1 A GLY 712 ? A GLY 17 198 10 Y 1 A SER 713 ? A SER 18 199 10 Y 1 A HIS 714 ? A HIS 19 200 10 Y 1 A MET 715 ? A MET 20 201 11 Y 1 A GLY 696 ? A GLY 1 202 11 Y 1 A SER 697 ? A SER 2 203 11 Y 1 A SER 698 ? A SER 3 204 11 Y 1 A HIS 699 ? A HIS 4 205 11 Y 1 A HIS 700 ? A HIS 5 206 11 Y 1 A HIS 701 ? A HIS 6 207 11 Y 1 A HIS 702 ? A HIS 7 208 11 Y 1 A HIS 703 ? A HIS 8 209 11 Y 1 A HIS 704 ? A HIS 9 210 11 Y 1 A SER 705 ? A SER 10 211 11 Y 1 A SER 706 ? A SER 11 212 11 Y 1 A GLY 707 ? A GLY 12 213 11 Y 1 A LEU 708 ? A LEU 13 214 11 Y 1 A VAL 709 ? A VAL 14 215 11 Y 1 A PRO 710 ? A PRO 15 216 11 Y 1 A ARG 711 ? A ARG 16 217 11 Y 1 A GLY 712 ? A GLY 17 218 11 Y 1 A SER 713 ? A SER 18 219 11 Y 1 A HIS 714 ? A HIS 19 220 11 Y 1 A MET 715 ? A MET 20 221 12 Y 1 A GLY 696 ? A GLY 1 222 12 Y 1 A SER 697 ? A SER 2 223 12 Y 1 A SER 698 ? A SER 3 224 12 Y 1 A HIS 699 ? A HIS 4 225 12 Y 1 A HIS 700 ? A HIS 5 226 12 Y 1 A HIS 701 ? A HIS 6 227 12 Y 1 A HIS 702 ? A HIS 7 228 12 Y 1 A HIS 703 ? A HIS 8 229 12 Y 1 A HIS 704 ? A HIS 9 230 12 Y 1 A SER 705 ? A SER 10 231 12 Y 1 A SER 706 ? A SER 11 232 12 Y 1 A GLY 707 ? A GLY 12 233 12 Y 1 A LEU 708 ? A LEU 13 234 12 Y 1 A VAL 709 ? A VAL 14 235 12 Y 1 A PRO 710 ? A PRO 15 236 12 Y 1 A ARG 711 ? A ARG 16 237 12 Y 1 A GLY 712 ? A GLY 17 238 12 Y 1 A SER 713 ? A SER 18 239 12 Y 1 A HIS 714 ? A HIS 19 240 12 Y 1 A MET 715 ? A MET 20 241 13 Y 1 A GLY 696 ? A GLY 1 242 13 Y 1 A SER 697 ? A SER 2 243 13 Y 1 A SER 698 ? A SER 3 244 13 Y 1 A HIS 699 ? A HIS 4 245 13 Y 1 A HIS 700 ? A HIS 5 246 13 Y 1 A HIS 701 ? A HIS 6 247 13 Y 1 A HIS 702 ? A HIS 7 248 13 Y 1 A HIS 703 ? A HIS 8 249 13 Y 1 A HIS 704 ? A HIS 9 250 13 Y 1 A SER 705 ? A SER 10 251 13 Y 1 A SER 706 ? A SER 11 252 13 Y 1 A GLY 707 ? A GLY 12 253 13 Y 1 A LEU 708 ? A LEU 13 254 13 Y 1 A VAL 709 ? A VAL 14 255 13 Y 1 A PRO 710 ? A PRO 15 256 13 Y 1 A ARG 711 ? A ARG 16 257 13 Y 1 A GLY 712 ? A GLY 17 258 13 Y 1 A SER 713 ? A SER 18 259 13 Y 1 A HIS 714 ? A HIS 19 260 13 Y 1 A MET 715 ? A MET 20 261 14 Y 1 A GLY 696 ? A GLY 1 262 14 Y 1 A SER 697 ? A SER 2 263 14 Y 1 A SER 698 ? A SER 3 264 14 Y 1 A HIS 699 ? A HIS 4 265 14 Y 1 A HIS 700 ? A HIS 5 266 14 Y 1 A HIS 701 ? A HIS 6 267 14 Y 1 A HIS 702 ? A HIS 7 268 14 Y 1 A HIS 703 ? A HIS 8 269 14 Y 1 A HIS 704 ? A HIS 9 270 14 Y 1 A SER 705 ? A SER 10 271 14 Y 1 A SER 706 ? A SER 11 272 14 Y 1 A GLY 707 ? A GLY 12 273 14 Y 1 A LEU 708 ? A LEU 13 274 14 Y 1 A VAL 709 ? A VAL 14 275 14 Y 1 A PRO 710 ? A PRO 15 276 14 Y 1 A ARG 711 ? A ARG 16 277 14 Y 1 A GLY 712 ? A GLY 17 278 14 Y 1 A SER 713 ? A SER 18 279 14 Y 1 A HIS 714 ? A HIS 19 280 14 Y 1 A MET 715 ? A MET 20 281 15 Y 1 A GLY 696 ? A GLY 1 282 15 Y 1 A SER 697 ? A SER 2 283 15 Y 1 A SER 698 ? A SER 3 284 15 Y 1 A HIS 699 ? A HIS 4 285 15 Y 1 A HIS 700 ? A HIS 5 286 15 Y 1 A HIS 701 ? A HIS 6 287 15 Y 1 A HIS 702 ? A HIS 7 288 15 Y 1 A HIS 703 ? A HIS 8 289 15 Y 1 A HIS 704 ? A HIS 9 290 15 Y 1 A SER 705 ? A SER 10 291 15 Y 1 A SER 706 ? A SER 11 292 15 Y 1 A GLY 707 ? A GLY 12 293 15 Y 1 A LEU 708 ? A LEU 13 294 15 Y 1 A VAL 709 ? A VAL 14 295 15 Y 1 A PRO 710 ? A PRO 15 296 15 Y 1 A ARG 711 ? A ARG 16 297 15 Y 1 A GLY 712 ? A GLY 17 298 15 Y 1 A SER 713 ? A SER 18 299 15 Y 1 A HIS 714 ? A HIS 19 300 15 Y 1 A MET 715 ? A MET 20 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLU N N N N 74 GLU CA C N S 75 GLU C C N N 76 GLU O O N N 77 GLU CB C N N 78 GLU CG C N N 79 GLU CD C N N 80 GLU OE1 O N N 81 GLU OE2 O N N 82 GLU OXT O N N 83 GLU H H N N 84 GLU H2 H N N 85 GLU HA H N N 86 GLU HB2 H N N 87 GLU HB3 H N N 88 GLU HG2 H N N 89 GLU HG3 H N N 90 GLU HE2 H N N 91 GLU HXT H N N 92 GLY N N N N 93 GLY CA C N N 94 GLY C C N N 95 GLY O O N N 96 GLY OXT O N N 97 GLY H H N N 98 GLY H2 H N N 99 GLY HA2 H N N 100 GLY HA3 H N N 101 GLY HXT H N N 102 HIS N N N N 103 HIS CA C N S 104 HIS C C N N 105 HIS O O N N 106 HIS CB C N N 107 HIS CG C Y N 108 HIS ND1 N Y N 109 HIS CD2 C Y N 110 HIS CE1 C Y N 111 HIS NE2 N Y N 112 HIS OXT O N N 113 HIS H H N N 114 HIS H2 H N N 115 HIS HA H N N 116 HIS HB2 H N N 117 HIS HB3 H N N 118 HIS HD1 H N N 119 HIS HD2 H N N 120 HIS HE1 H N N 121 HIS HE2 H N N 122 HIS HXT H N N 123 ILE N N N N 124 ILE CA C N S 125 ILE C C N N 126 ILE O O N N 127 ILE CB C N S 128 ILE CG1 C N N 129 ILE CG2 C N N 130 ILE CD1 C N N 131 ILE OXT O N N 132 ILE H H N N 133 ILE H2 H N N 134 ILE HA H N N 135 ILE HB H N N 136 ILE HG12 H N N 137 ILE HG13 H N N 138 ILE HG21 H N N 139 ILE HG22 H N N 140 ILE HG23 H N N 141 ILE HD11 H N N 142 ILE HD12 H N N 143 ILE HD13 H N N 144 ILE HXT H N N 145 LEU N N N N 146 LEU CA C N S 147 LEU C C N N 148 LEU O O N N 149 LEU CB C N N 150 LEU CG C N N 151 LEU CD1 C N N 152 LEU CD2 C N N 153 LEU OXT O N N 154 LEU H H N N 155 LEU H2 H N N 156 LEU HA H N N 157 LEU HB2 H N N 158 LEU HB3 H N N 159 LEU HG H N N 160 LEU HD11 H N N 161 LEU HD12 H N N 162 LEU HD13 H N N 163 LEU HD21 H N N 164 LEU HD22 H N N 165 LEU HD23 H N N 166 LEU HXT H N N 167 LYS N N N N 168 LYS CA C N S 169 LYS C C N N 170 LYS O O N N 171 LYS CB C N N 172 LYS CG C N N 173 LYS CD C N N 174 LYS CE C N N 175 LYS NZ N N N 176 LYS OXT O N N 177 LYS H H N N 178 LYS H2 H N N 179 LYS HA H N N 180 LYS HB2 H N N 181 LYS HB3 H N N 182 LYS HG2 H N N 183 LYS HG3 H N N 184 LYS HD2 H N N 185 LYS HD3 H N N 186 LYS HE2 H N N 187 LYS HE3 H N N 188 LYS HZ1 H N N 189 LYS HZ2 H N N 190 LYS HZ3 H N N 191 LYS HXT H N N 192 MET N N N N 193 MET CA C N S 194 MET C C N N 195 MET O O N N 196 MET CB C N N 197 MET CG C N N 198 MET SD S N N 199 MET CE C N N 200 MET OXT O N N 201 MET H H N N 202 MET H2 H N N 203 MET HA H N N 204 MET HB2 H N N 205 MET HB3 H N N 206 MET HG2 H N N 207 MET HG3 H N N 208 MET HE1 H N N 209 MET HE2 H N N 210 MET HE3 H N N 211 MET HXT H N N 212 PHE N N N N 213 PHE CA C N S 214 PHE C C N N 215 PHE O O N N 216 PHE CB C N N 217 PHE CG C Y N 218 PHE CD1 C Y N 219 PHE CD2 C Y N 220 PHE CE1 C Y N 221 PHE CE2 C Y N 222 PHE CZ C Y N 223 PHE OXT O N N 224 PHE H H N N 225 PHE H2 H N N 226 PHE HA H N N 227 PHE HB2 H N N 228 PHE HB3 H N N 229 PHE HD1 H N N 230 PHE HD2 H N N 231 PHE HE1 H N N 232 PHE HE2 H N N 233 PHE HZ H N N 234 PHE HXT H N N 235 PRO N N N N 236 PRO CA C N S 237 PRO C C N N 238 PRO O O N N 239 PRO CB C N N 240 PRO CG C N N 241 PRO CD C N N 242 PRO OXT O N N 243 PRO H H N N 244 PRO HA H N N 245 PRO HB2 H N N 246 PRO HB3 H N N 247 PRO HG2 H N N 248 PRO HG3 H N N 249 PRO HD2 H N N 250 PRO HD3 H N N 251 PRO HXT H N N 252 PTR N N N N 253 PTR CA C N S 254 PTR C C N N 255 PTR O O N N 256 PTR OXT O N N 257 PTR CB C N N 258 PTR CG C Y N 259 PTR CD1 C Y N 260 PTR CD2 C Y N 261 PTR CE1 C Y N 262 PTR CE2 C Y N 263 PTR CZ C Y N 264 PTR OH O N N 265 PTR P P N N 266 PTR O1P O N N 267 PTR O2P O N N 268 PTR O3P O N N 269 PTR H H N N 270 PTR H2 H N N 271 PTR HA H N N 272 PTR HXT H N N 273 PTR HB2 H N N 274 PTR HB3 H N N 275 PTR HD1 H N N 276 PTR HD2 H N N 277 PTR HE1 H N N 278 PTR HE2 H N N 279 PTR HO2P H N N 280 PTR HO3P H N N 281 SER N N N N 282 SER CA C N S 283 SER C C N N 284 SER O O N N 285 SER CB C N N 286 SER OG O N N 287 SER OXT O N N 288 SER H H N N 289 SER H2 H N N 290 SER HA H N N 291 SER HB2 H N N 292 SER HB3 H N N 293 SER HG H N N 294 SER HXT H N N 295 THR N N N N 296 THR CA C N S 297 THR C C N N 298 THR O O N N 299 THR CB C N R 300 THR OG1 O N N 301 THR CG2 C N N 302 THR OXT O N N 303 THR H H N N 304 THR H2 H N N 305 THR HA H N N 306 THR HB H N N 307 THR HG1 H N N 308 THR HG21 H N N 309 THR HG22 H N N 310 THR HG23 H N N 311 THR HXT H N N 312 TRP N N N N 313 TRP CA C N S 314 TRP C C N N 315 TRP O O N N 316 TRP CB C N N 317 TRP CG C Y N 318 TRP CD1 C Y N 319 TRP CD2 C Y N 320 TRP NE1 N Y N 321 TRP CE2 C Y N 322 TRP CE3 C Y N 323 TRP CZ2 C Y N 324 TRP CZ3 C Y N 325 TRP CH2 C Y N 326 TRP OXT O N N 327 TRP H H N N 328 TRP H2 H N N 329 TRP HA H N N 330 TRP HB2 H N N 331 TRP HB3 H N N 332 TRP HD1 H N N 333 TRP HE1 H N N 334 TRP HE3 H N N 335 TRP HZ2 H N N 336 TRP HZ3 H N N 337 TRP HH2 H N N 338 TRP HXT H N N 339 TYR N N N N 340 TYR CA C N S 341 TYR C C N N 342 TYR O O N N 343 TYR CB C N N 344 TYR CG C Y N 345 TYR CD1 C Y N 346 TYR CD2 C Y N 347 TYR CE1 C Y N 348 TYR CE2 C Y N 349 TYR CZ C Y N 350 TYR OH O N N 351 TYR OXT O N N 352 TYR H H N N 353 TYR H2 H N N 354 TYR HA H N N 355 TYR HB2 H N N 356 TYR HB3 H N N 357 TYR HD1 H N N 358 TYR HD2 H N N 359 TYR HE1 H N N 360 TYR HE2 H N N 361 TYR HH H N N 362 TYR HXT H N N 363 VAL N N N N 364 VAL CA C N S 365 VAL C C N N 366 VAL O O N N 367 VAL CB C N N 368 VAL CG1 C N N 369 VAL CG2 C N N 370 VAL OXT O N N 371 VAL H H N N 372 VAL H2 H N N 373 VAL HA H N N 374 VAL HB H N N 375 VAL HG11 H N N 376 VAL HG12 H N N 377 VAL HG13 H N N 378 VAL HG21 H N N 379 VAL HG22 H N N 380 VAL HG23 H N N 381 VAL HXT H N N 382 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLU N CA sing N N 70 GLU N H sing N N 71 GLU N H2 sing N N 72 GLU CA C sing N N 73 GLU CA CB sing N N 74 GLU CA HA sing N N 75 GLU C O doub N N 76 GLU C OXT sing N N 77 GLU CB CG sing N N 78 GLU CB HB2 sing N N 79 GLU CB HB3 sing N N 80 GLU CG CD sing N N 81 GLU CG HG2 sing N N 82 GLU CG HG3 sing N N 83 GLU CD OE1 doub N N 84 GLU CD OE2 sing N N 85 GLU OE2 HE2 sing N N 86 GLU OXT HXT sing N N 87 GLY N CA sing N N 88 GLY N H sing N N 89 GLY N H2 sing N N 90 GLY CA C sing N N 91 GLY CA HA2 sing N N 92 GLY CA HA3 sing N N 93 GLY C O doub N N 94 GLY C OXT sing N N 95 GLY OXT HXT sing N N 96 HIS N CA sing N N 97 HIS N H sing N N 98 HIS N H2 sing N N 99 HIS CA C sing N N 100 HIS CA CB sing N N 101 HIS CA HA sing N N 102 HIS C O doub N N 103 HIS C OXT sing N N 104 HIS CB CG sing N N 105 HIS CB HB2 sing N N 106 HIS CB HB3 sing N N 107 HIS CG ND1 sing Y N 108 HIS CG CD2 doub Y N 109 HIS ND1 CE1 doub Y N 110 HIS ND1 HD1 sing N N 111 HIS CD2 NE2 sing Y N 112 HIS CD2 HD2 sing N N 113 HIS CE1 NE2 sing Y N 114 HIS CE1 HE1 sing N N 115 HIS NE2 HE2 sing N N 116 HIS OXT HXT sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 PRO N CA sing N N 226 PRO N CD sing N N 227 PRO N H sing N N 228 PRO CA C sing N N 229 PRO CA CB sing N N 230 PRO CA HA sing N N 231 PRO C O doub N N 232 PRO C OXT sing N N 233 PRO CB CG sing N N 234 PRO CB HB2 sing N N 235 PRO CB HB3 sing N N 236 PRO CG CD sing N N 237 PRO CG HG2 sing N N 238 PRO CG HG3 sing N N 239 PRO CD HD2 sing N N 240 PRO CD HD3 sing N N 241 PRO OXT HXT sing N N 242 PTR N CA sing N N 243 PTR N H sing N N 244 PTR N H2 sing N N 245 PTR CA C sing N N 246 PTR CA CB sing N N 247 PTR CA HA sing N N 248 PTR C O doub N N 249 PTR C OXT sing N N 250 PTR OXT HXT sing N N 251 PTR CB CG sing N N 252 PTR CB HB2 sing N N 253 PTR CB HB3 sing N N 254 PTR CG CD1 doub Y N 255 PTR CG CD2 sing Y N 256 PTR CD1 CE1 sing Y N 257 PTR CD1 HD1 sing N N 258 PTR CD2 CE2 doub Y N 259 PTR CD2 HD2 sing N N 260 PTR CE1 CZ doub Y N 261 PTR CE1 HE1 sing N N 262 PTR CE2 CZ sing Y N 263 PTR CE2 HE2 sing N N 264 PTR CZ OH sing N N 265 PTR OH P sing N N 266 PTR P O1P doub N N 267 PTR P O2P sing N N 268 PTR P O3P sing N N 269 PTR O2P HO2P sing N N 270 PTR O3P HO3P sing N N 271 SER N CA sing N N 272 SER N H sing N N 273 SER N H2 sing N N 274 SER CA C sing N N 275 SER CA CB sing N N 276 SER CA HA sing N N 277 SER C O doub N N 278 SER C OXT sing N N 279 SER CB OG sing N N 280 SER CB HB2 sing N N 281 SER CB HB3 sing N N 282 SER OG HG sing N N 283 SER OXT HXT sing N N 284 THR N CA sing N N 285 THR N H sing N N 286 THR N H2 sing N N 287 THR CA C sing N N 288 THR CA CB sing N N 289 THR CA HA sing N N 290 THR C O doub N N 291 THR C OXT sing N N 292 THR CB OG1 sing N N 293 THR CB CG2 sing N N 294 THR CB HB sing N N 295 THR OG1 HG1 sing N N 296 THR CG2 HG21 sing N N 297 THR CG2 HG22 sing N N 298 THR CG2 HG23 sing N N 299 THR OXT HXT sing N N 300 TRP N CA sing N N 301 TRP N H sing N N 302 TRP N H2 sing N N 303 TRP CA C sing N N 304 TRP CA CB sing N N 305 TRP CA HA sing N N 306 TRP C O doub N N 307 TRP C OXT sing N N 308 TRP CB CG sing N N 309 TRP CB HB2 sing N N 310 TRP CB HB3 sing N N 311 TRP CG CD1 doub Y N 312 TRP CG CD2 sing Y N 313 TRP CD1 NE1 sing Y N 314 TRP CD1 HD1 sing N N 315 TRP CD2 CE2 doub Y N 316 TRP CD2 CE3 sing Y N 317 TRP NE1 CE2 sing Y N 318 TRP NE1 HE1 sing N N 319 TRP CE2 CZ2 sing Y N 320 TRP CE3 CZ3 doub Y N 321 TRP CE3 HE3 sing N N 322 TRP CZ2 CH2 doub Y N 323 TRP CZ2 HZ2 sing N N 324 TRP CZ3 CH2 sing Y N 325 TRP CZ3 HZ3 sing N N 326 TRP CH2 HH2 sing N N 327 TRP OXT HXT sing N N 328 TYR N CA sing N N 329 TYR N H sing N N 330 TYR N H2 sing N N 331 TYR CA C sing N N 332 TYR CA CB sing N N 333 TYR CA HA sing N N 334 TYR C O doub N N 335 TYR C OXT sing N N 336 TYR CB CG sing N N 337 TYR CB HB2 sing N N 338 TYR CB HB3 sing N N 339 TYR CG CD1 doub Y N 340 TYR CG CD2 sing Y N 341 TYR CD1 CE1 sing Y N 342 TYR CD1 HD1 sing N N 343 TYR CD2 CE2 doub Y N 344 TYR CD2 HD2 sing N N 345 TYR CE1 CZ doub Y N 346 TYR CE1 HE1 sing N N 347 TYR CE2 CZ sing Y N 348 TYR CE2 HE2 sing N N 349 TYR CZ OH sing N N 350 TYR OH HH sing N N 351 TYR OXT HXT sing N N 352 VAL N CA sing N N 353 VAL N H sing N N 354 VAL N H2 sing N N 355 VAL CA C sing N N 356 VAL CA CB sing N N 357 VAL CA HA sing N N 358 VAL C O doub N N 359 VAL C OXT sing N N 360 VAL CB CG1 sing N N 361 VAL CB CG2 sing N N 362 VAL CB HB sing N N 363 VAL CG1 HG11 sing N N 364 VAL CG1 HG12 sing N N 365 VAL CG1 HG13 sing N N 366 VAL CG2 HG21 sing N N 367 VAL CG2 HG22 sing N N 368 VAL CG2 HG23 sing N N 369 VAL OXT HXT sing N N 370 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _atom_sites.entry_id 2LJF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P # loop_