data_2LJP # _entry.id 2LJP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LJP pdb_00002ljp 10.2210/pdb2ljp/pdb RCSB RCSB102465 ? ? BMRB 17952 ? ? WWPDB D_1000102465 ? ? # _pdbx_database_related.db_id 17952 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LJP _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2011-09-21 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shin, J.' 1 'Kim, K.' 2 'Ryu, K.' 3 'Han, K.' 4 'Lee, Y.' 5 'Choi, B.' 6 # _citation.id primary _citation.title 'Structural analysis of Escherichia coli C5 protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shin, J.' 1 ? primary 'Kim, K.' 2 ? primary 'Ryu, K.' 3 ? primary 'Han, K.' 4 ? primary 'Lee, Y.' 5 ? primary 'Choi, B.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ribonuclease P protein component' _entity.formula_weight 13818.256 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.26.5 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNase P protein, RNaseP protein, Protein C5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVKLAFPRELRLLTPSQFTFVFQQPQRAGTPQITILGRLNSLGHPRIGLTVAKKNVRRAHERNRIKRLTRESFRLRQHEL PAMDFVVVAKKGVADLDNRALSEALEKLWRRHCRLARGS ; _entity_poly.pdbx_seq_one_letter_code_can ;MVKLAFPRELRLLTPSQFTFVFQQPQRAGTPQITILGRLNSLGHPRIGLTVAKKNVRRAHERNRIKRLTRESFRLRQHEL PAMDFVVVAKKGVADLDNRALSEALEKLWRRHCRLARGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 LYS n 1 4 LEU n 1 5 ALA n 1 6 PHE n 1 7 PRO n 1 8 ARG n 1 9 GLU n 1 10 LEU n 1 11 ARG n 1 12 LEU n 1 13 LEU n 1 14 THR n 1 15 PRO n 1 16 SER n 1 17 GLN n 1 18 PHE n 1 19 THR n 1 20 PHE n 1 21 VAL n 1 22 PHE n 1 23 GLN n 1 24 GLN n 1 25 PRO n 1 26 GLN n 1 27 ARG n 1 28 ALA n 1 29 GLY n 1 30 THR n 1 31 PRO n 1 32 GLN n 1 33 ILE n 1 34 THR n 1 35 ILE n 1 36 LEU n 1 37 GLY n 1 38 ARG n 1 39 LEU n 1 40 ASN n 1 41 SER n 1 42 LEU n 1 43 GLY n 1 44 HIS n 1 45 PRO n 1 46 ARG n 1 47 ILE n 1 48 GLY n 1 49 LEU n 1 50 THR n 1 51 VAL n 1 52 ALA n 1 53 LYS n 1 54 LYS n 1 55 ASN n 1 56 VAL n 1 57 ARG n 1 58 ARG n 1 59 ALA n 1 60 HIS n 1 61 GLU n 1 62 ARG n 1 63 ASN n 1 64 ARG n 1 65 ILE n 1 66 LYS n 1 67 ARG n 1 68 LEU n 1 69 THR n 1 70 ARG n 1 71 GLU n 1 72 SER n 1 73 PHE n 1 74 ARG n 1 75 LEU n 1 76 ARG n 1 77 GLN n 1 78 HIS n 1 79 GLU n 1 80 LEU n 1 81 PRO n 1 82 ALA n 1 83 MET n 1 84 ASP n 1 85 PHE n 1 86 VAL n 1 87 VAL n 1 88 VAL n 1 89 ALA n 1 90 LYS n 1 91 LYS n 1 92 GLY n 1 93 VAL n 1 94 ALA n 1 95 ASP n 1 96 LEU n 1 97 ASP n 1 98 ASN n 1 99 ARG n 1 100 ALA n 1 101 LEU n 1 102 SER n 1 103 GLU n 1 104 ALA n 1 105 LEU n 1 106 GLU n 1 107 LYS n 1 108 LEU n 1 109 TRP n 1 110 ARG n 1 111 ARG n 1 112 HIS n 1 113 CYS n 1 114 ARG n 1 115 LEU n 1 116 ALA n 1 117 ARG n 1 118 GLY n 1 119 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rnpA, b3704, JW3681' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pSSC5 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RNPA_ECOLI _struct_ref.pdbx_db_accession P0A7Y8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVKLAFPRELRLLTPSQFTFVFQQPQRAGTPQITILGRLNSLGHPRIGLTVAKKNVRRAHERNRIKRLTRESFRLRQHEL PAMDFVVVAKKGVADLDNRALSEALEKLWRRHCRLARGS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LJP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 119 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A7Y8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 119 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 119 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D C(CO)NH' 1 5 1 '3D HNCO' 1 6 1 '3D HNCACB' 1 7 1 '3D HBHA(CO)NH' 1 8 1 '3D HCCH-TOCSY' 1 9 1 '3D HCCH-COSY' 1 10 1 '3D 1H-13C NOESY aliphatic' 1 11 1 '3D 1H-15N NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.8 mM [U-95% 13C; U-95% 15N] E.coli Ribonuclease P protein-1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LJP _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LJP _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LJP _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 1 2.1 Goddard 'data analysis' Sparky 2 ? ? refinement CNS 3 1.21 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 4 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LJP _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LJP _struct.title 'Backbone 1H, 13C, and 15N Chemical Shift Assignments for E.coli Ribonuclease P protein' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LJP _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'RNaseP, C5, ribonuclease P, Ribozyme, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 6 ? ARG A 11 ? PHE A 6 ARG A 11 5 ? 6 HELX_P HELX_P2 2 SER A 16 ? GLN A 24 ? SER A 16 GLN A 24 1 ? 9 HELX_P HELX_P3 3 ARG A 58 ? ARG A 74 ? ARG A 58 ARG A 74 1 ? 17 HELX_P HELX_P4 4 GLY A 92 ? LEU A 96 ? GLY A 92 LEU A 96 5 ? 5 HELX_P HELX_P5 5 ASP A 97 ? GLY A 118 ? ASP A 97 GLY A 118 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 33 ? ILE A 35 ? ILE A 33 ILE A 35 A 2 VAL A 87 ? ALA A 89 ? VAL A 87 ALA A 89 B 1 ARG A 46 ? ILE A 47 ? ARG A 46 ILE A 47 B 2 ASP A 84 ? PHE A 85 ? ASP A 84 PHE A 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 34 ? N THR A 34 O VAL A 88 ? O VAL A 88 B 1 2 N ARG A 46 ? N ARG A 46 O PHE A 85 ? O PHE A 85 # _atom_sites.entry_id 2LJP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 CYS 113 113 113 CYS CYS A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 SER 119 119 119 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-12-07 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_exptl_sample.component 'E.coli Ribonuclease P protein-1' _pdbx_nmr_exptl_sample.concentration 0.8 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-95% 13C; U-95% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LJP _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total ? _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 84 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 84 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 OE1 A GLU 79 ? ? HG A CYS 113 ? ? 1.58 2 13 OE2 A GLU 61 ? ? HH21 A ARG 64 ? ? 1.59 3 20 O A LEU 13 ? ? HG1 A THR 14 ? ? 1.57 4 20 OE2 A GLU 9 ? ? HH12 A ARG 38 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 2 ? ? -126.07 -52.65 2 1 LEU A 39 ? ? -69.37 94.43 3 1 ARG A 76 ? ? -99.03 40.76 4 2 THR A 14 ? ? 48.20 72.07 5 2 GLN A 24 ? ? -151.34 88.07 6 2 PRO A 31 ? ? -69.98 0.13 7 2 SER A 41 ? ? -75.63 32.18 8 2 LYS A 53 ? ? -69.27 5.32 9 2 ARG A 74 ? ? -128.52 -50.21 10 2 ARG A 76 ? ? -105.30 44.42 11 2 GLU A 79 ? ? -143.96 30.15 12 3 LEU A 10 ? ? -179.48 -51.95 13 3 ARG A 57 ? ? -101.42 41.36 14 4 ARG A 11 ? ? 63.14 85.18 15 4 THR A 14 ? ? 67.04 82.46 16 4 PRO A 15 ? ? -77.39 45.90 17 4 ARG A 38 ? ? -170.47 -71.06 18 4 ARG A 76 ? ? -103.16 46.59 19 4 PRO A 81 ? ? -76.65 -157.42 20 4 ALA A 82 ? ? -78.54 45.71 21 5 LEU A 12 ? ? -69.61 86.59 22 5 GLN A 24 ? ? -151.34 81.40 23 5 ARG A 38 ? ? -147.24 -82.94 24 5 LEU A 39 ? ? 170.33 90.94 25 5 ASP A 95 ? ? -147.26 32.85 26 6 GLN A 24 ? ? -169.59 77.65 27 6 LEU A 39 ? ? -169.92 -104.67 28 6 ASN A 40 ? ? 178.18 157.46 29 6 ARG A 57 ? ? -101.06 -63.22 30 6 ASP A 95 ? ? -95.83 35.51 31 6 LEU A 115 ? ? -125.62 -50.43 32 7 PRO A 7 ? ? -66.33 1.47 33 7 LEU A 12 ? ? -59.01 106.84 34 7 PRO A 15 ? ? -49.65 96.64 35 7 SER A 16 ? ? -172.34 123.50 36 7 ASN A 40 ? ? -67.08 98.79 37 7 LYS A 54 ? ? -130.06 -36.78 38 7 ARG A 57 ? ? -108.34 74.97 39 7 ARG A 58 ? ? -161.10 -149.39 40 7 ALA A 59 ? ? -134.21 -47.55 41 7 HIS A 78 ? ? 167.08 -33.14 42 8 ARG A 11 ? ? 75.27 91.41 43 8 THR A 14 ? ? 52.72 89.46 44 8 PRO A 15 ? ? -56.59 98.33 45 8 GLN A 24 ? ? -155.12 86.79 46 8 LEU A 42 ? ? -149.31 -49.13 47 8 ARG A 46 ? ? -110.29 -169.69 48 8 ALA A 59 ? ? -120.91 -88.86 49 8 ALA A 82 ? ? -80.08 44.31 50 9 LYS A 3 ? ? -151.32 -73.55 51 9 GLU A 9 ? ? -152.18 -63.18 52 9 ARG A 11 ? ? -176.74 149.92 53 9 PRO A 15 ? ? -61.09 96.56 54 9 GLN A 24 ? ? -159.79 89.26 55 9 LEU A 39 ? ? -66.35 87.90 56 10 LEU A 4 ? ? 56.91 73.49 57 10 ARG A 76 ? ? -97.71 38.07 58 11 LEU A 4 ? ? -81.63 47.06 59 11 ARG A 8 ? ? -68.62 93.57 60 11 GLU A 9 ? ? -160.11 -82.83 61 11 PRO A 15 ? ? -76.48 34.81 62 11 PRO A 45 ? ? -41.59 95.24 63 11 ILE A 47 ? ? -59.64 99.52 64 11 ARG A 57 ? ? -85.97 38.88 65 11 ALA A 82 ? ? -57.81 104.84 66 11 LYS A 90 ? ? -101.98 -161.92 67 12 LEU A 4 ? ? -168.01 -69.28 68 12 ALA A 5 ? ? 179.12 94.91 69 12 LEU A 13 ? ? -117.02 -167.95 70 12 GLN A 24 ? ? -163.13 96.13 71 12 LEU A 42 ? ? -122.08 -65.21 72 12 ARG A 76 ? ? -95.67 44.53 73 13 LEU A 4 ? ? 76.38 -57.85 74 13 PHE A 20 ? ? -130.36 -47.57 75 13 PRO A 45 ? ? -72.90 40.59 76 13 ALA A 82 ? ? -68.41 83.79 77 14 GLN A 24 ? ? -156.46 88.80 78 14 SER A 41 ? ? -83.68 36.93 79 14 PRO A 45 ? ? -68.28 96.44 80 14 LYS A 54 ? ? -150.46 -26.95 81 14 MET A 83 ? ? -125.39 -166.27 82 14 ASP A 95 ? ? -92.18 56.58 83 14 CYS A 113 ? ? -99.02 -63.13 84 15 LEU A 4 ? ? -82.70 38.75 85 15 ALA A 5 ? ? -162.97 115.63 86 15 ARG A 11 ? ? -101.68 -61.73 87 15 LEU A 36 ? ? -103.37 -96.51 88 15 SER A 41 ? ? -165.59 92.08 89 15 LEU A 42 ? ? -170.42 -66.59 90 15 LEU A 49 ? ? -64.81 99.40 91 15 ARG A 74 ? ? -139.18 -36.07 92 15 LEU A 80 ? ? -171.59 135.12 93 15 ASP A 95 ? ? -175.18 -25.98 94 16 GLN A 24 ? ? -176.91 89.28 95 16 LEU A 42 ? ? -166.59 -47.57 96 16 LYS A 54 ? ? -155.33 17.43 97 16 ASN A 55 ? ? -151.72 -64.77 98 16 ARG A 57 ? ? -106.59 -68.85 99 17 PRO A 45 ? ? -31.87 98.97 100 17 ALA A 59 ? ? -117.11 -76.54 101 17 GLU A 71 ? ? -99.36 -64.13 102 17 ALA A 116 ? ? -165.01 -35.72 103 18 VAL A 2 ? ? -143.29 -30.15 104 18 GLN A 24 ? ? -155.47 77.44 105 18 ARG A 70 ? ? -90.74 -67.35 106 18 ARG A 76 ? ? -95.32 54.22 107 18 ALA A 82 ? ? -66.14 95.14 108 19 PRO A 7 ? ? -58.64 102.97 109 19 THR A 19 ? ? -143.57 -30.03 110 19 GLN A 23 ? ? -70.32 -71.61 111 19 ARG A 38 ? ? -179.64 73.08 112 19 ARG A 76 ? ? -105.94 50.37 113 20 LYS A 3 ? ? -144.92 -157.00 114 20 THR A 14 ? ? 60.27 164.13 115 20 PRO A 15 ? ? -68.16 91.89 116 20 GLN A 24 ? ? -153.88 81.47 117 20 ARG A 58 ? ? -137.88 -69.61 118 20 ALA A 59 ? ? -166.01 -50.43 119 20 GLN A 77 ? ? 177.98 -19.09 #