data_2LJY # _entry.id 2LJY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LJY RCSB RCSB102473 BMRB 17968 WWPDB D_1000102473 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2ljx PDB 'Structure of the monomeric N-terminal domain of HPV16 E6 oncoprotein' unspecified 17967 BMRB 'Structure of the monomeric N-terminal domain of HPV16 E6 oncoprotein' unspecified 17968 BMRB . unspecified 2LJZ PDB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LJY _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-09-30 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zanier, K.' 1 'Muhamed Sidi, A.' 2 'Boulade-Ladame, C.' 3 'Rybin, V.' 4 'Chappelle, A.' 5 'Atkinson, A.' 6 'Kieffer, B.' 7 'Trave, G.' 8 # _citation.id primary _citation.title ;Solution Structure Analysis of the HPV16 E6 Oncoprotein Reveals a Self-Association Mechanism Required for E6-Mediated Degradation of p53. ; _citation.journal_abbrev Structure _citation.journal_volume 20 _citation.page_first 604 _citation.page_last 617 _citation.year 2012 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22483108 _citation.pdbx_database_id_DOI 10.1016/j.str.2012.02.001 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zanier, K.' 1 primary ;Ould M'hamed Ould Sidi, A. ; 2 primary 'Boulade-Ladame, C.' 3 primary 'Rybin, V.' 4 primary 'Chappelle, A.' 5 primary 'Atkinson, A.' 6 primary 'Kieffer, B.' 7 primary 'Trave, G.' 8 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein E6' 10138.669 2 ? C80S 'Zinc finger containing residues 7-86' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRH YSYS ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRH YSYS ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 PHE n 1 5 GLN n 1 6 ASP n 1 7 PRO n 1 8 GLN n 1 9 GLU n 1 10 ARG n 1 11 PRO n 1 12 ARG n 1 13 LYS n 1 14 LEU n 1 15 PRO n 1 16 GLN n 1 17 LEU n 1 18 CYS n 1 19 THR n 1 20 GLU n 1 21 LEU n 1 22 GLN n 1 23 THR n 1 24 THR n 1 25 ILE n 1 26 HIS n 1 27 ASP n 1 28 ILE n 1 29 ILE n 1 30 LEU n 1 31 GLU n 1 32 CYS n 1 33 VAL n 1 34 TYR n 1 35 CYS n 1 36 LYS n 1 37 GLN n 1 38 GLN n 1 39 LEU n 1 40 LEU n 1 41 ARG n 1 42 ARG n 1 43 GLU n 1 44 VAL n 1 45 TYR n 1 46 ASP n 1 47 PHE n 1 48 ALA n 1 49 PHE n 1 50 ARG n 1 51 ASP n 1 52 LEU n 1 53 CYS n 1 54 ILE n 1 55 VAL n 1 56 TYR n 1 57 ARG n 1 58 ASP n 1 59 GLY n 1 60 ASN n 1 61 PRO n 1 62 TYR n 1 63 ALA n 1 64 VAL n 1 65 CYS n 1 66 ASP n 1 67 LYS n 1 68 CYS n 1 69 LEU n 1 70 LYS n 1 71 PHE n 1 72 TYR n 1 73 SER n 1 74 LYS n 1 75 ILE n 1 76 SER n 1 77 GLU n 1 78 TYR n 1 79 ARG n 1 80 HIS n 1 81 TYR n 1 82 SER n 1 83 TYR n 1 84 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene E6 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'type 16' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human papillomavirus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 333760 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector petM41 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VE6_HPV16 _struct_ref.pdbx_db_accession P03126 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHY CYS ; _struct_ref.pdbx_align_begin 7 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LJY A 2 ? 84 ? P03126 7 ? 89 ? 0 82 2 1 2LJY B 2 ? 84 ? P03126 7 ? 89 ? 0 82 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LJY GLY A 1 ? UNP P03126 ? ? 'EXPRESSION TAG' -1 1 1 2LJY SER A 82 ? UNP P03126 CYS 87 'ENGINEERED MUTATION' 80 2 2 2LJY GLY B 1 ? UNP P03126 ? ? 'EXPRESSION TAG' -1 3 2 2LJY SER B 82 ? UNP P03126 CYS 87 'ENGINEERED MUTATION' 80 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '2D 1H-15N HSQC' 1 2 3 '2D 1H-13C HSQC aliphatic' 1 3 3 '2D 1H-13C HSQC aromatic' 1 4 3 '3D HNCA' 1 5 3 '3D HNCACB' 1 6 3 '3D HN(CO)CA' 1 7 3 '3D HCCH-TOCSY' 1 8 3 '3D HCCH-COSY' 1 9 2 '3D 1H-15N NOESY' 1 10 3 '3D 1H-13C NOESY aliphatic' 1 11 1 '2D 1H-1H NOESY' 1 12 1 '2D 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.3 mM E6, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.3 mM [U-100% 15N] E6, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '0.3 mM [U-100% 13C; U-100% 15N] E6, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker DRX 1 'Bruker DRX' 700 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LJY _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2LJY _pdbx_nmr_details.text ;The dimer structures were calculated using Ambiguous Interaction restrains, unambiguous inter-molecular NOE-derived distance restraints and dihedral angles. ; # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 1.07 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LJY _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 4.23 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method xplor # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LJY _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TOPSPIN 2.1 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Keller and Wuthrich' 'data analysis' CARA 1.8.3 3 'Utrecht Biomolecular Interaction web portal' 'structure calculation' HADDOCK_webserver ? 4 'Utrecht Biomolecular Interaction web portal' refinement HADDOCK_webserver ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'NMR data driven model structure of the N-terminal domain dimer of HPV16 E6 calculated using Haddock' _exptl.entry_id 2LJY _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LJY _struct.title 'Haddock model structure of the N-terminal domain dimer of HPV16 E6' _struct.pdbx_descriptor 'Protein E6' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LJY _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 13 ? LEU A 21 ? LYS A 11 LEU A 19 1 ? 9 HELX_P HELX_P2 2 LEU A 40 ? ARG A 50 ? LEU A 38 ARG A 48 1 ? 11 HELX_P HELX_P3 3 LYS A 67 ? PHE A 71 ? LYS A 65 PHE A 69 5 ? 5 HELX_P HELX_P4 4 LYS B 13 ? LEU B 21 ? LYS B 11 LEU B 19 1 ? 9 HELX_P HELX_P5 5 LEU B 40 ? ARG B 50 ? LEU B 38 ARG B 48 1 ? 11 HELX_P HELX_P6 6 CYS B 65 ? LYS B 70 ? CYS B 63 LYS B 68 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A CYS 32 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 30 A ZN 200 1_555 ? ? ? ? ? ? ? 1.993 ? metalc2 metalc ? ? B CYS 68 SG ? ? ? 1_555 D ZN . ZN ? ? B CYS 66 B ZN 200 1_555 ? ? ? ? ? ? ? 2.020 ? metalc3 metalc ? ? A CYS 65 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 63 A ZN 200 1_555 ? ? ? ? ? ? ? 2.021 ? metalc4 metalc ? ? A CYS 68 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 66 A ZN 200 1_555 ? ? ? ? ? ? ? 2.036 ? metalc5 metalc ? ? B CYS 32 SG ? ? ? 1_555 D ZN . ZN ? ? B CYS 30 B ZN 200 1_555 ? ? ? ? ? ? ? 2.052 ? metalc6 metalc ? ? B CYS 65 SG ? ? ? 1_555 D ZN . ZN ? ? B CYS 63 B ZN 200 1_555 ? ? ? ? ? ? ? 2.059 ? metalc7 metalc ? ? B CYS 35 SG ? ? ? 1_555 D ZN . ZN ? ? B CYS 33 B ZN 200 1_555 ? ? ? ? ? ? ? 2.086 ? metalc8 metalc ? ? A CYS 35 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 33 A ZN 200 1_555 ? ? ? ? ? ? ? 2.096 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 1 1.38 2 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 1 0.22 3 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 2 -0.35 4 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 2 0.33 5 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 3 0.56 6 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 3 1.61 7 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 4 -0.15 8 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 4 1.02 9 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 5 0.32 10 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 5 1.59 11 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 6 1.28 12 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 6 0.64 13 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 7 0.84 14 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 7 1.14 15 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 8 1.05 16 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 8 0.39 17 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 9 0.86 18 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 9 0.59 19 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 10 0.62 20 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 10 -1.56 21 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 11 0.54 22 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 11 0.49 23 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 12 0.41 24 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 12 1.06 25 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 13 1.18 26 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 13 0.01 27 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 14 -0.61 28 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 14 -0.10 29 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 15 0.09 30 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 15 0.75 31 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 16 0.07 32 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 16 1.35 33 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 17 1.12 34 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 17 0.61 35 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 18 1.10 36 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 18 0.70 37 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 19 0.37 38 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 19 -0.96 39 ASP 6 A . ? ASP 4 A PRO 7 A ? PRO 5 A 20 0.33 40 ASP 6 B . ? ASP 4 B PRO 7 B ? PRO 5 B 20 1.05 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 55 ? ARG A 57 ? VAL A 53 ARG A 55 A 2 ASN A 60 ? TYR A 62 ? ASN A 58 TYR A 60 B 1 GLU B 31 ? CYS B 32 ? GLU B 29 CYS B 30 B 2 ASN B 60 ? ALA B 63 ? ASN B 58 ALA B 61 B 3 VAL B 55 ? ARG B 57 ? VAL B 53 ARG B 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 55 ? N VAL A 53 O TYR A 62 ? O TYR A 60 B 1 2 N GLU B 31 ? N GLU B 29 O ALA B 63 ? O ALA B 61 B 2 3 O TYR B 62 ? O TYR B 60 N VAL B 55 ? N VAL B 53 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 200' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 200' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 32 ? CYS A 30 . ? 1_555 ? 2 AC1 4 CYS A 35 ? CYS A 33 . ? 1_555 ? 3 AC1 4 CYS A 65 ? CYS A 63 . ? 1_555 ? 4 AC1 4 CYS A 68 ? CYS A 66 . ? 1_555 ? 5 AC2 4 CYS B 32 ? CYS B 30 . ? 1_555 ? 6 AC2 4 CYS B 35 ? CYS B 33 . ? 1_555 ? 7 AC2 4 CYS B 65 ? CYS B 63 . ? 1_555 ? 8 AC2 4 CYS B 68 ? CYS B 66 . ? 1_555 ? # _atom_sites.entry_id 2LJY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 ALA 2 0 ? ? ? A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 PHE 4 2 2 PHE PHE A . n A 1 5 GLN 5 3 3 GLN GLN A . n A 1 6 ASP 6 4 4 ASP ASP A . n A 1 7 PRO 7 5 5 PRO PRO A . n A 1 8 GLN 8 6 6 GLN GLN A . n A 1 9 GLU 9 7 7 GLU GLU A . n A 1 10 ARG 10 8 8 ARG ARG A . n A 1 11 PRO 11 9 9 PRO PRO A . n A 1 12 ARG 12 10 10 ARG ARG A . n A 1 13 LYS 13 11 11 LYS LYS A . n A 1 14 LEU 14 12 12 LEU LEU A . n A 1 15 PRO 15 13 13 PRO PRO A . n A 1 16 GLN 16 14 14 GLN GLN A . n A 1 17 LEU 17 15 15 LEU LEU A . n A 1 18 CYS 18 16 16 CYS CYS A . n A 1 19 THR 19 17 17 THR THR A . n A 1 20 GLU 20 18 18 GLU GLU A . n A 1 21 LEU 21 19 19 LEU LEU A . n A 1 22 GLN 22 20 20 GLN GLN A . n A 1 23 THR 23 21 21 THR THR A . n A 1 24 THR 24 22 22 THR THR A . n A 1 25 ILE 25 23 23 ILE ILE A . n A 1 26 HIS 26 24 24 HIS HIS A . n A 1 27 ASP 27 25 25 ASP ASP A . n A 1 28 ILE 28 26 26 ILE ILE A . n A 1 29 ILE 29 27 27 ILE ILE A . n A 1 30 LEU 30 28 28 LEU LEU A . n A 1 31 GLU 31 29 29 GLU GLU A . n A 1 32 CYS 32 30 30 CYS CYS A . n A 1 33 VAL 33 31 31 VAL VAL A . n A 1 34 TYR 34 32 32 TYR TYR A . n A 1 35 CYS 35 33 33 CYS CYS A . n A 1 36 LYS 36 34 34 LYS LYS A . n A 1 37 GLN 37 35 35 GLN GLN A . n A 1 38 GLN 38 36 36 GLN GLN A . n A 1 39 LEU 39 37 37 LEU LEU A . n A 1 40 LEU 40 38 38 LEU LEU A . n A 1 41 ARG 41 39 39 ARG ARG A . n A 1 42 ARG 42 40 40 ARG ARG A . n A 1 43 GLU 43 41 41 GLU GLU A . n A 1 44 VAL 44 42 42 VAL VAL A . n A 1 45 TYR 45 43 43 TYR TYR A . n A 1 46 ASP 46 44 44 ASP ASP A . n A 1 47 PHE 47 45 45 PHE PHE A . n A 1 48 ALA 48 46 46 ALA ALA A . n A 1 49 PHE 49 47 47 PHE PHE A . n A 1 50 ARG 50 48 48 ARG ARG A . n A 1 51 ASP 51 49 49 ASP ASP A . n A 1 52 LEU 52 50 50 LEU LEU A . n A 1 53 CYS 53 51 51 CYS CYS A . n A 1 54 ILE 54 52 52 ILE ILE A . n A 1 55 VAL 55 53 53 VAL VAL A . n A 1 56 TYR 56 54 54 TYR TYR A . n A 1 57 ARG 57 55 55 ARG ARG A . n A 1 58 ASP 58 56 56 ASP ASP A . n A 1 59 GLY 59 57 57 GLY GLY A . n A 1 60 ASN 60 58 58 ASN ASN A . n A 1 61 PRO 61 59 59 PRO PRO A . n A 1 62 TYR 62 60 60 TYR TYR A . n A 1 63 ALA 63 61 61 ALA ALA A . n A 1 64 VAL 64 62 62 VAL VAL A . n A 1 65 CYS 65 63 63 CYS CYS A . n A 1 66 ASP 66 64 64 ASP ASP A . n A 1 67 LYS 67 65 65 LYS LYS A . n A 1 68 CYS 68 66 66 CYS CYS A . n A 1 69 LEU 69 67 67 LEU LEU A . n A 1 70 LYS 70 68 68 LYS LYS A . n A 1 71 PHE 71 69 69 PHE PHE A . n A 1 72 TYR 72 70 70 TYR TYR A . n A 1 73 SER 73 71 ? ? ? A . n A 1 74 LYS 74 72 ? ? ? A . n A 1 75 ILE 75 73 ? ? ? A . n A 1 76 SER 76 74 ? ? ? A . n A 1 77 GLU 77 75 ? ? ? A . n A 1 78 TYR 78 76 ? ? ? A . n A 1 79 ARG 79 77 ? ? ? A . n A 1 80 HIS 80 78 ? ? ? A . n A 1 81 TYR 81 79 ? ? ? A . n A 1 82 SER 82 80 ? ? ? A . n A 1 83 TYR 83 81 ? ? ? A . n A 1 84 SER 84 82 ? ? ? A . n B 1 1 GLY 1 -1 ? ? ? B . n B 1 2 ALA 2 0 ? ? ? B . n B 1 3 MET 3 1 1 MET MET B . n B 1 4 PHE 4 2 2 PHE PHE B . n B 1 5 GLN 5 3 3 GLN GLN B . n B 1 6 ASP 6 4 4 ASP ASP B . n B 1 7 PRO 7 5 5 PRO PRO B . n B 1 8 GLN 8 6 6 GLN GLN B . n B 1 9 GLU 9 7 7 GLU GLU B . n B 1 10 ARG 10 8 8 ARG ARG B . n B 1 11 PRO 11 9 9 PRO PRO B . n B 1 12 ARG 12 10 10 ARG ARG B . n B 1 13 LYS 13 11 11 LYS LYS B . n B 1 14 LEU 14 12 12 LEU LEU B . n B 1 15 PRO 15 13 13 PRO PRO B . n B 1 16 GLN 16 14 14 GLN GLN B . n B 1 17 LEU 17 15 15 LEU LEU B . n B 1 18 CYS 18 16 16 CYS CYS B . n B 1 19 THR 19 17 17 THR THR B . n B 1 20 GLU 20 18 18 GLU GLU B . n B 1 21 LEU 21 19 19 LEU LEU B . n B 1 22 GLN 22 20 20 GLN GLN B . n B 1 23 THR 23 21 21 THR THR B . n B 1 24 THR 24 22 22 THR THR B . n B 1 25 ILE 25 23 23 ILE ILE B . n B 1 26 HIS 26 24 24 HIS HIS B . n B 1 27 ASP 27 25 25 ASP ASP B . n B 1 28 ILE 28 26 26 ILE ILE B . n B 1 29 ILE 29 27 27 ILE ILE B . n B 1 30 LEU 30 28 28 LEU LEU B . n B 1 31 GLU 31 29 29 GLU GLU B . n B 1 32 CYS 32 30 30 CYS CYS B . n B 1 33 VAL 33 31 31 VAL VAL B . n B 1 34 TYR 34 32 32 TYR TYR B . n B 1 35 CYS 35 33 33 CYS CYS B . n B 1 36 LYS 36 34 34 LYS LYS B . n B 1 37 GLN 37 35 35 GLN GLN B . n B 1 38 GLN 38 36 36 GLN GLN B . n B 1 39 LEU 39 37 37 LEU LEU B . n B 1 40 LEU 40 38 38 LEU LEU B . n B 1 41 ARG 41 39 39 ARG ARG B . n B 1 42 ARG 42 40 40 ARG ARG B . n B 1 43 GLU 43 41 41 GLU GLU B . n B 1 44 VAL 44 42 42 VAL VAL B . n B 1 45 TYR 45 43 43 TYR TYR B . n B 1 46 ASP 46 44 44 ASP ASP B . n B 1 47 PHE 47 45 45 PHE PHE B . n B 1 48 ALA 48 46 46 ALA ALA B . n B 1 49 PHE 49 47 47 PHE PHE B . n B 1 50 ARG 50 48 48 ARG ARG B . n B 1 51 ASP 51 49 49 ASP ASP B . n B 1 52 LEU 52 50 50 LEU LEU B . n B 1 53 CYS 53 51 51 CYS CYS B . n B 1 54 ILE 54 52 52 ILE ILE B . n B 1 55 VAL 55 53 53 VAL VAL B . n B 1 56 TYR 56 54 54 TYR TYR B . n B 1 57 ARG 57 55 55 ARG ARG B . n B 1 58 ASP 58 56 56 ASP ASP B . n B 1 59 GLY 59 57 57 GLY GLY B . n B 1 60 ASN 60 58 58 ASN ASN B . n B 1 61 PRO 61 59 59 PRO PRO B . n B 1 62 TYR 62 60 60 TYR TYR B . n B 1 63 ALA 63 61 61 ALA ALA B . n B 1 64 VAL 64 62 62 VAL VAL B . n B 1 65 CYS 65 63 63 CYS CYS B . n B 1 66 ASP 66 64 64 ASP ASP B . n B 1 67 LYS 67 65 65 LYS LYS B . n B 1 68 CYS 68 66 66 CYS CYS B . n B 1 69 LEU 69 67 67 LEU LEU B . n B 1 70 LYS 70 68 68 LYS LYS B . n B 1 71 PHE 71 69 69 PHE PHE B . n B 1 72 TYR 72 70 70 TYR TYR B . n B 1 73 SER 73 71 ? ? ? B . n B 1 74 LYS 74 72 ? ? ? B . n B 1 75 ILE 75 73 ? ? ? B . n B 1 76 SER 76 74 ? ? ? B . n B 1 77 GLU 77 75 ? ? ? B . n B 1 78 TYR 78 76 ? ? ? B . n B 1 79 ARG 79 77 ? ? ? B . n B 1 80 HIS 80 78 ? ? ? B . n B 1 81 TYR 81 79 ? ? ? B . n B 1 82 SER 82 80 ? ? ? B . n B 1 83 TYR 83 81 ? ? ? B . n B 1 84 SER 84 82 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 ZN 1 200 200 ZN ZN A . D 2 ZN 1 200 200 ZN ZN B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 32 ? A CYS 30 ? 1_555 ZN ? C ZN . ? A ZN 200 ? 1_555 SG ? A CYS 65 ? A CYS 63 ? 1_555 117.5 ? 2 SG ? A CYS 32 ? A CYS 30 ? 1_555 ZN ? C ZN . ? A ZN 200 ? 1_555 SG ? A CYS 68 ? A CYS 66 ? 1_555 115.8 ? 3 SG ? A CYS 65 ? A CYS 63 ? 1_555 ZN ? C ZN . ? A ZN 200 ? 1_555 SG ? A CYS 68 ? A CYS 66 ? 1_555 105.9 ? 4 SG ? A CYS 32 ? A CYS 30 ? 1_555 ZN ? C ZN . ? A ZN 200 ? 1_555 SG ? A CYS 35 ? A CYS 33 ? 1_555 102.7 ? 5 SG ? A CYS 65 ? A CYS 63 ? 1_555 ZN ? C ZN . ? A ZN 200 ? 1_555 SG ? A CYS 35 ? A CYS 33 ? 1_555 108.9 ? 6 SG ? A CYS 68 ? A CYS 66 ? 1_555 ZN ? C ZN . ? A ZN 200 ? 1_555 SG ? A CYS 35 ? A CYS 33 ? 1_555 105.2 ? 7 SG ? B CYS 68 ? B CYS 66 ? 1_555 ZN ? D ZN . ? B ZN 200 ? 1_555 SG ? B CYS 32 ? B CYS 30 ? 1_555 111.3 ? 8 SG ? B CYS 68 ? B CYS 66 ? 1_555 ZN ? D ZN . ? B ZN 200 ? 1_555 SG ? B CYS 65 ? B CYS 63 ? 1_555 109.1 ? 9 SG ? B CYS 32 ? B CYS 30 ? 1_555 ZN ? D ZN . ? B ZN 200 ? 1_555 SG ? B CYS 65 ? B CYS 63 ? 1_555 110.6 ? 10 SG ? B CYS 68 ? B CYS 66 ? 1_555 ZN ? D ZN . ? B ZN 200 ? 1_555 SG ? B CYS 35 ? B CYS 33 ? 1_555 106.7 ? 11 SG ? B CYS 32 ? B CYS 30 ? 1_555 ZN ? D ZN . ? B ZN 200 ? 1_555 SG ? B CYS 35 ? B CYS 33 ? 1_555 105.1 ? 12 SG ? B CYS 65 ? B CYS 63 ? 1_555 ZN ? D ZN . ? B ZN 200 ? 1_555 SG ? B CYS 35 ? B CYS 33 ? 1_555 113.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-04-04 2 'Structure model' 1 1 2012-04-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.093 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.072 _pdbx_nmr_ensemble_rms.entry_id 2LJY _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id E6-1 0.3 ? mM ? 1 E6-2 0.3 ? mM '[U-100% 15N]' 2 E6-3 0.3 ? mM '[U-100% 13C; U-100% 15N]' 3 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LJY _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total ? _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 37 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 37 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 OD2 B ASP 44 ? ? HH21 B ARG 48 ? ? 1.59 2 2 OE1 B GLU 29 ? ? HZ1 B LYS 34 ? ? 1.60 3 2 HZ3 A LYS 11 ? ? OD1 A ASP 49 ? ? 1.60 4 3 OD1 A ASP 44 ? ? HH12 A ARG 48 ? ? 1.60 5 6 HZ2 A LYS 11 ? ? OD1 A ASP 49 ? ? 1.58 6 6 OD2 B ASP 44 ? ? HH12 B ARG 48 ? ? 1.59 7 8 OE1 B GLU 29 ? ? HZ3 B LYS 34 ? ? 1.59 8 8 HZ2 A LYS 11 ? ? OD1 A ASP 49 ? ? 1.59 9 10 OD1 B ASP 64 ? ? HZ3 B LYS 68 ? ? 1.58 10 10 HZ2 B LYS 11 ? ? OD1 B ASP 49 ? ? 1.59 11 11 OE1 A GLU 29 ? ? HZ2 A LYS 34 ? ? 1.56 12 11 OD2 B ASP 44 ? ? HH21 B ARG 48 ? ? 1.58 13 12 OD1 A ASP 64 ? ? HH22 B ARG 39 ? ? 1.60 14 12 HH21 A ARG 40 ? ? OD2 A ASP 44 ? ? 1.60 15 13 HZ3 B LYS 11 ? ? OD1 B ASP 49 ? ? 1.58 16 14 OD2 A ASP 64 ? ? HZ1 A LYS 68 ? ? 1.56 17 14 OE2 A GLU 29 ? ? HZ2 A LYS 34 ? ? 1.57 18 15 OD1 A ASP 44 ? ? HH12 A ARG 48 ? ? 1.55 19 16 HZ2 A LYS 11 ? ? OD1 A ASP 49 ? ? 1.59 20 17 OE2 B GLU 29 ? ? HZ1 B LYS 34 ? ? 1.57 21 19 OD2 B ASP 44 ? ? HH21 B ARG 48 ? ? 1.58 22 19 HZ2 B LYS 11 ? ? OD1 B ASP 49 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 8 ? ? 69.41 80.39 2 1 TYR A 32 ? ? -95.25 -61.33 3 1 ASP A 56 ? ? 70.99 -68.02 4 1 ARG B 8 ? ? 55.74 76.72 5 1 TYR B 32 ? ? -104.49 -60.18 6 1 ASP B 49 ? ? -83.74 45.88 7 1 ASP B 56 ? ? 73.72 -26.67 8 1 PRO B 59 ? ? -67.96 97.10 9 2 GLU A 7 ? ? 70.93 -46.44 10 2 ARG A 8 ? ? 65.45 75.59 11 2 ASP A 56 ? ? 75.92 -46.94 12 2 PRO B 5 ? ? -97.31 36.76 13 2 ARG B 8 ? ? 73.40 132.94 14 2 PRO B 9 ? ? -76.90 -166.03 15 2 ASP B 49 ? ? -57.03 105.88 16 2 ASP B 56 ? ? 73.52 -72.20 17 3 ARG A 8 ? ? 69.89 143.66 18 3 PRO A 9 ? ? -79.35 -153.05 19 3 ASP A 49 ? ? -112.83 70.13 20 3 ASP A 56 ? ? 71.30 -7.44 21 3 ARG B 8 ? ? 69.17 86.35 22 3 ASP B 56 ? ? 70.94 -77.53 23 4 GLN A 3 ? ? -125.10 -165.19 24 4 ARG A 8 ? ? 66.49 74.83 25 4 ARG B 10 ? ? -77.98 20.08 26 4 ASP B 25 ? ? -130.31 -39.09 27 4 LEU B 50 ? ? -110.28 -167.81 28 4 ASP B 56 ? ? 68.78 -78.06 29 5 GLN A 3 ? ? -127.90 -164.44 30 5 ARG A 8 ? ? 68.84 72.89 31 5 TYR A 32 ? ? -104.22 -63.01 32 5 ASP A 56 ? ? 72.06 -71.14 33 5 ARG B 8 ? ? 68.65 81.69 34 5 TYR B 32 ? ? -101.46 -67.06 35 5 ASP B 56 ? ? 68.72 -77.46 36 6 ARG A 8 ? ? 68.36 79.67 37 6 TYR A 32 ? ? -92.91 -67.83 38 6 ASP A 56 ? ? 71.71 -69.58 39 6 ARG B 8 ? ? 68.44 89.77 40 6 ASP B 25 ? ? -131.29 -32.37 41 6 TYR B 32 ? ? -102.91 -60.35 42 6 ARG B 48 ? ? -92.84 -140.14 43 6 ASP B 56 ? ? 71.53 -71.51 44 7 ARG A 8 ? ? 63.41 72.77 45 7 GLN B 3 ? ? -125.74 -168.12 46 7 ARG B 8 ? ? 64.86 78.86 47 7 ASP B 56 ? ? 69.79 -76.50 48 8 GLN A 3 ? ? -111.85 -158.65 49 8 ARG A 8 ? ? 60.86 71.60 50 8 ASP A 56 ? ? 70.59 -81.97 51 8 PRO B 5 ? ? -93.19 30.71 52 8 ARG B 8 ? ? 68.95 101.97 53 8 CYS B 51 ? ? 73.93 142.27 54 8 ASP B 56 ? ? 74.27 -34.97 55 9 ARG A 8 ? ? 77.43 86.53 56 9 ASP A 56 ? ? 73.67 -60.20 57 9 ARG B 8 ? ? 68.92 82.36 58 9 ASP B 25 ? ? -132.58 -33.50 59 9 TYR B 32 ? ? -98.49 -64.13 60 9 ASP B 56 ? ? 70.24 -71.96 61 10 GLN A 3 ? ? -132.01 -151.54 62 10 ARG A 8 ? ? 65.84 85.42 63 10 ASP A 25 ? ? -136.62 -31.89 64 10 ASP A 56 ? ? 72.47 -57.87 65 10 GLN B 3 ? ? -113.41 -166.71 66 10 PRO B 5 ? ? -92.30 -61.26 67 10 GLU B 7 ? ? 69.02 -56.37 68 10 ARG B 8 ? ? 71.25 84.05 69 10 ASP B 25 ? ? -168.86 -39.94 70 10 TYR B 32 ? ? -102.97 -71.92 71 10 ASP B 56 ? ? 75.90 -39.78 72 11 GLN A 6 ? ? -157.77 69.87 73 11 ASP A 56 ? ? 73.49 -17.93 74 11 PRO B 5 ? ? -84.47 -103.08 75 11 GLN B 6 ? ? -97.79 50.96 76 11 GLU B 7 ? ? -87.07 47.51 77 11 ASP B 56 ? ? 68.27 -83.91 78 12 GLN A 3 ? ? -119.73 -162.15 79 12 ARG A 8 ? ? 64.20 88.27 80 12 TYR A 32 ? ? -101.57 -70.70 81 12 LEU A 50 ? ? -54.50 109.21 82 12 CYS A 51 ? ? -68.98 -171.45 83 12 ASP A 56 ? ? 70.09 -73.16 84 12 ALA A 61 ? ? -126.39 -168.44 85 12 GLN B 3 ? ? -138.22 -158.65 86 12 ARG B 8 ? ? 66.22 83.95 87 13 ARG A 8 ? ? 69.00 86.00 88 13 ASP A 25 ? ? -132.98 -37.70 89 13 ASP A 56 ? ? 71.45 -71.01 90 13 PRO B 5 ? ? -88.37 -71.57 91 13 GLN B 6 ? ? 69.67 -8.50 92 13 GLU B 7 ? ? 72.21 -53.00 93 13 ARG B 8 ? ? 68.99 86.26 94 13 ASP B 56 ? ? 68.96 -64.27 95 14 PRO A 5 ? ? -92.47 -73.53 96 14 GLN A 6 ? ? -101.78 70.25 97 14 ASP A 56 ? ? 74.98 -45.84 98 14 PRO B 5 ? ? -90.63 -88.00 99 14 ASP B 56 ? ? 71.35 -73.58 100 15 ARG A 8 ? ? 68.33 148.94 101 15 PRO A 9 ? ? -82.65 -147.41 102 15 ASP A 56 ? ? 71.55 -62.04 103 15 ARG B 8 ? ? 69.79 93.30 104 16 PRO A 5 ? ? -90.60 -76.90 105 16 GLN A 6 ? ? 70.95 -1.41 106 16 GLU A 7 ? ? 70.96 -42.34 107 16 ARG A 8 ? ? 76.64 117.00 108 16 ARG B 8 ? ? 64.45 89.10 109 16 ASP B 56 ? ? 70.99 -72.14 110 17 ARG A 8 ? ? 69.88 82.98 111 17 ASP A 56 ? ? 71.70 -69.01 112 17 PRO B 5 ? ? -88.34 -82.76 113 17 GLN B 6 ? ? -100.87 78.16 114 17 ASP B 56 ? ? 73.40 -52.92 115 18 ARG A 8 ? ? 68.32 86.92 116 18 ASP A 56 ? ? 68.96 -74.07 117 18 ARG B 8 ? ? 61.78 71.77 118 18 ASP B 49 ? ? -69.23 95.06 119 18 ASP B 56 ? ? 73.72 -51.41 120 19 GLN A 3 ? ? -128.83 -162.10 121 19 ARG A 8 ? ? 67.89 92.37 122 19 TYR A 32 ? ? -101.83 -65.04 123 19 ASP A 56 ? ? 69.13 -70.46 124 19 PRO B 5 ? ? -88.51 -82.32 125 19 ASP B 49 ? ? -68.07 94.64 126 19 ASP B 56 ? ? 74.59 -44.43 127 19 ALA B 61 ? ? -127.63 -163.80 128 20 GLN A 3 ? ? -144.46 -159.07 129 20 ARG A 8 ? ? 66.55 84.74 130 20 HIS A 24 ? ? -86.49 49.17 131 20 ASP A 25 ? ? -168.39 -39.38 132 20 ASP A 56 ? ? 72.43 -70.74 133 20 PHE B 2 ? ? -153.23 88.31 134 20 GLN B 3 ? ? -108.90 -169.65 135 20 ARG B 8 ? ? 67.62 79.96 136 20 TYR B 32 ? ? -85.15 -71.64 137 20 ASP B 56 ? ? 70.48 -70.64 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A ALA 0 ? A ALA 2 3 1 Y 1 A SER 71 ? A SER 73 4 1 Y 1 A LYS 72 ? A LYS 74 5 1 Y 1 A ILE 73 ? A ILE 75 6 1 Y 1 A SER 74 ? A SER 76 7 1 Y 1 A GLU 75 ? A GLU 77 8 1 Y 1 A TYR 76 ? A TYR 78 9 1 Y 1 A ARG 77 ? A ARG 79 10 1 Y 1 A HIS 78 ? A HIS 80 11 1 Y 1 A TYR 79 ? A TYR 81 12 1 Y 1 A SER 80 ? A SER 82 13 1 Y 1 A TYR 81 ? A TYR 83 14 1 Y 1 A SER 82 ? A SER 84 15 1 Y 1 B GLY -1 ? B GLY 1 16 1 Y 1 B ALA 0 ? B ALA 2 17 1 Y 1 B SER 71 ? B SER 73 18 1 Y 1 B LYS 72 ? B LYS 74 19 1 Y 1 B ILE 73 ? B ILE 75 20 1 Y 1 B SER 74 ? B SER 76 21 1 Y 1 B GLU 75 ? B GLU 77 22 1 Y 1 B TYR 76 ? B TYR 78 23 1 Y 1 B ARG 77 ? B ARG 79 24 1 Y 1 B HIS 78 ? B HIS 80 25 1 Y 1 B TYR 79 ? B TYR 81 26 1 Y 1 B SER 80 ? B SER 82 27 1 Y 1 B TYR 81 ? B TYR 83 28 1 Y 1 B SER 82 ? B SER 84 29 2 Y 1 A GLY -1 ? A GLY 1 30 2 Y 1 A ALA 0 ? A ALA 2 31 2 Y 1 A SER 71 ? A SER 73 32 2 Y 1 A LYS 72 ? A LYS 74 33 2 Y 1 A ILE 73 ? A ILE 75 34 2 Y 1 A SER 74 ? A SER 76 35 2 Y 1 A GLU 75 ? A GLU 77 36 2 Y 1 A TYR 76 ? A TYR 78 37 2 Y 1 A ARG 77 ? A ARG 79 38 2 Y 1 A HIS 78 ? A HIS 80 39 2 Y 1 A TYR 79 ? A TYR 81 40 2 Y 1 A SER 80 ? A SER 82 41 2 Y 1 A TYR 81 ? A TYR 83 42 2 Y 1 A SER 82 ? A SER 84 43 2 Y 1 B GLY -1 ? B GLY 1 44 2 Y 1 B ALA 0 ? B ALA 2 45 2 Y 1 B SER 71 ? B SER 73 46 2 Y 1 B LYS 72 ? B LYS 74 47 2 Y 1 B ILE 73 ? B ILE 75 48 2 Y 1 B SER 74 ? B SER 76 49 2 Y 1 B GLU 75 ? B GLU 77 50 2 Y 1 B TYR 76 ? B TYR 78 51 2 Y 1 B ARG 77 ? B ARG 79 52 2 Y 1 B HIS 78 ? B HIS 80 53 2 Y 1 B TYR 79 ? B TYR 81 54 2 Y 1 B SER 80 ? B SER 82 55 2 Y 1 B TYR 81 ? B TYR 83 56 2 Y 1 B SER 82 ? B SER 84 57 3 Y 1 A GLY -1 ? A GLY 1 58 3 Y 1 A ALA 0 ? A ALA 2 59 3 Y 1 A SER 71 ? A SER 73 60 3 Y 1 A LYS 72 ? A LYS 74 61 3 Y 1 A ILE 73 ? A ILE 75 62 3 Y 1 A SER 74 ? A SER 76 63 3 Y 1 A GLU 75 ? A GLU 77 64 3 Y 1 A TYR 76 ? A TYR 78 65 3 Y 1 A ARG 77 ? A ARG 79 66 3 Y 1 A HIS 78 ? A HIS 80 67 3 Y 1 A TYR 79 ? A TYR 81 68 3 Y 1 A SER 80 ? A SER 82 69 3 Y 1 A TYR 81 ? A TYR 83 70 3 Y 1 A SER 82 ? A SER 84 71 3 Y 1 B GLY -1 ? B GLY 1 72 3 Y 1 B ALA 0 ? B ALA 2 73 3 Y 1 B SER 71 ? B SER 73 74 3 Y 1 B LYS 72 ? B LYS 74 75 3 Y 1 B ILE 73 ? B ILE 75 76 3 Y 1 B SER 74 ? B SER 76 77 3 Y 1 B GLU 75 ? B GLU 77 78 3 Y 1 B TYR 76 ? B TYR 78 79 3 Y 1 B ARG 77 ? B ARG 79 80 3 Y 1 B HIS 78 ? B HIS 80 81 3 Y 1 B TYR 79 ? B TYR 81 82 3 Y 1 B SER 80 ? B SER 82 83 3 Y 1 B TYR 81 ? B TYR 83 84 3 Y 1 B SER 82 ? B SER 84 85 4 Y 1 A GLY -1 ? A GLY 1 86 4 Y 1 A ALA 0 ? A ALA 2 87 4 Y 1 A SER 71 ? A SER 73 88 4 Y 1 A LYS 72 ? A LYS 74 89 4 Y 1 A ILE 73 ? A ILE 75 90 4 Y 1 A SER 74 ? A SER 76 91 4 Y 1 A GLU 75 ? A GLU 77 92 4 Y 1 A TYR 76 ? A TYR 78 93 4 Y 1 A ARG 77 ? A ARG 79 94 4 Y 1 A HIS 78 ? A HIS 80 95 4 Y 1 A TYR 79 ? A TYR 81 96 4 Y 1 A SER 80 ? A SER 82 97 4 Y 1 A TYR 81 ? A TYR 83 98 4 Y 1 A SER 82 ? A SER 84 99 4 Y 1 B GLY -1 ? B GLY 1 100 4 Y 1 B ALA 0 ? B ALA 2 101 4 Y 1 B SER 71 ? B SER 73 102 4 Y 1 B LYS 72 ? B LYS 74 103 4 Y 1 B ILE 73 ? B ILE 75 104 4 Y 1 B SER 74 ? B SER 76 105 4 Y 1 B GLU 75 ? B GLU 77 106 4 Y 1 B TYR 76 ? B TYR 78 107 4 Y 1 B ARG 77 ? B ARG 79 108 4 Y 1 B HIS 78 ? B HIS 80 109 4 Y 1 B TYR 79 ? B TYR 81 110 4 Y 1 B SER 80 ? B SER 82 111 4 Y 1 B TYR 81 ? B TYR 83 112 4 Y 1 B SER 82 ? B SER 84 113 5 Y 1 A GLY -1 ? A GLY 1 114 5 Y 1 A ALA 0 ? A ALA 2 115 5 Y 1 A SER 71 ? A SER 73 116 5 Y 1 A LYS 72 ? A LYS 74 117 5 Y 1 A ILE 73 ? A ILE 75 118 5 Y 1 A SER 74 ? A SER 76 119 5 Y 1 A GLU 75 ? A GLU 77 120 5 Y 1 A TYR 76 ? A TYR 78 121 5 Y 1 A ARG 77 ? A ARG 79 122 5 Y 1 A HIS 78 ? A HIS 80 123 5 Y 1 A TYR 79 ? A TYR 81 124 5 Y 1 A SER 80 ? A SER 82 125 5 Y 1 A TYR 81 ? A TYR 83 126 5 Y 1 A SER 82 ? A SER 84 127 5 Y 1 B GLY -1 ? B GLY 1 128 5 Y 1 B ALA 0 ? B ALA 2 129 5 Y 1 B SER 71 ? B SER 73 130 5 Y 1 B LYS 72 ? B LYS 74 131 5 Y 1 B ILE 73 ? B ILE 75 132 5 Y 1 B SER 74 ? B SER 76 133 5 Y 1 B GLU 75 ? B GLU 77 134 5 Y 1 B TYR 76 ? B TYR 78 135 5 Y 1 B ARG 77 ? B ARG 79 136 5 Y 1 B HIS 78 ? B HIS 80 137 5 Y 1 B TYR 79 ? B TYR 81 138 5 Y 1 B SER 80 ? B SER 82 139 5 Y 1 B TYR 81 ? B TYR 83 140 5 Y 1 B SER 82 ? B SER 84 141 6 Y 1 A GLY -1 ? A GLY 1 142 6 Y 1 A ALA 0 ? A ALA 2 143 6 Y 1 A SER 71 ? A SER 73 144 6 Y 1 A LYS 72 ? A LYS 74 145 6 Y 1 A ILE 73 ? A ILE 75 146 6 Y 1 A SER 74 ? A SER 76 147 6 Y 1 A GLU 75 ? A GLU 77 148 6 Y 1 A TYR 76 ? A TYR 78 149 6 Y 1 A ARG 77 ? A ARG 79 150 6 Y 1 A HIS 78 ? A HIS 80 151 6 Y 1 A TYR 79 ? A TYR 81 152 6 Y 1 A SER 80 ? A SER 82 153 6 Y 1 A TYR 81 ? A TYR 83 154 6 Y 1 A SER 82 ? A SER 84 155 6 Y 1 B GLY -1 ? B GLY 1 156 6 Y 1 B ALA 0 ? B ALA 2 157 6 Y 1 B SER 71 ? B SER 73 158 6 Y 1 B LYS 72 ? B LYS 74 159 6 Y 1 B ILE 73 ? B ILE 75 160 6 Y 1 B SER 74 ? B SER 76 161 6 Y 1 B GLU 75 ? B GLU 77 162 6 Y 1 B TYR 76 ? B TYR 78 163 6 Y 1 B ARG 77 ? B ARG 79 164 6 Y 1 B HIS 78 ? B HIS 80 165 6 Y 1 B TYR 79 ? B TYR 81 166 6 Y 1 B SER 80 ? B SER 82 167 6 Y 1 B TYR 81 ? B TYR 83 168 6 Y 1 B SER 82 ? B SER 84 169 7 Y 1 A GLY -1 ? A GLY 1 170 7 Y 1 A ALA 0 ? A ALA 2 171 7 Y 1 A SER 71 ? A SER 73 172 7 Y 1 A LYS 72 ? A LYS 74 173 7 Y 1 A ILE 73 ? A ILE 75 174 7 Y 1 A SER 74 ? A SER 76 175 7 Y 1 A GLU 75 ? A GLU 77 176 7 Y 1 A TYR 76 ? A TYR 78 177 7 Y 1 A ARG 77 ? A ARG 79 178 7 Y 1 A HIS 78 ? A HIS 80 179 7 Y 1 A TYR 79 ? A TYR 81 180 7 Y 1 A SER 80 ? A SER 82 181 7 Y 1 A TYR 81 ? A TYR 83 182 7 Y 1 A SER 82 ? A SER 84 183 7 Y 1 B GLY -1 ? B GLY 1 184 7 Y 1 B ALA 0 ? B ALA 2 185 7 Y 1 B SER 71 ? B SER 73 186 7 Y 1 B LYS 72 ? B LYS 74 187 7 Y 1 B ILE 73 ? B ILE 75 188 7 Y 1 B SER 74 ? B SER 76 189 7 Y 1 B GLU 75 ? B GLU 77 190 7 Y 1 B TYR 76 ? B TYR 78 191 7 Y 1 B ARG 77 ? B ARG 79 192 7 Y 1 B HIS 78 ? B HIS 80 193 7 Y 1 B TYR 79 ? B TYR 81 194 7 Y 1 B SER 80 ? B SER 82 195 7 Y 1 B TYR 81 ? B TYR 83 196 7 Y 1 B SER 82 ? B SER 84 197 8 Y 1 A GLY -1 ? A GLY 1 198 8 Y 1 A ALA 0 ? A ALA 2 199 8 Y 1 A SER 71 ? A SER 73 200 8 Y 1 A LYS 72 ? A LYS 74 201 8 Y 1 A ILE 73 ? A ILE 75 202 8 Y 1 A SER 74 ? A SER 76 203 8 Y 1 A GLU 75 ? A GLU 77 204 8 Y 1 A TYR 76 ? A TYR 78 205 8 Y 1 A ARG 77 ? A ARG 79 206 8 Y 1 A HIS 78 ? A HIS 80 207 8 Y 1 A TYR 79 ? A TYR 81 208 8 Y 1 A SER 80 ? A SER 82 209 8 Y 1 A TYR 81 ? A TYR 83 210 8 Y 1 A SER 82 ? A SER 84 211 8 Y 1 B GLY -1 ? B GLY 1 212 8 Y 1 B ALA 0 ? B ALA 2 213 8 Y 1 B SER 71 ? B SER 73 214 8 Y 1 B LYS 72 ? B LYS 74 215 8 Y 1 B ILE 73 ? B ILE 75 216 8 Y 1 B SER 74 ? B SER 76 217 8 Y 1 B GLU 75 ? B GLU 77 218 8 Y 1 B TYR 76 ? B TYR 78 219 8 Y 1 B ARG 77 ? B ARG 79 220 8 Y 1 B HIS 78 ? B HIS 80 221 8 Y 1 B TYR 79 ? B TYR 81 222 8 Y 1 B SER 80 ? B SER 82 223 8 Y 1 B TYR 81 ? B TYR 83 224 8 Y 1 B SER 82 ? B SER 84 225 9 Y 1 A GLY -1 ? A GLY 1 226 9 Y 1 A ALA 0 ? A ALA 2 227 9 Y 1 A SER 71 ? A SER 73 228 9 Y 1 A LYS 72 ? A LYS 74 229 9 Y 1 A ILE 73 ? A ILE 75 230 9 Y 1 A SER 74 ? A SER 76 231 9 Y 1 A GLU 75 ? A GLU 77 232 9 Y 1 A TYR 76 ? A TYR 78 233 9 Y 1 A ARG 77 ? A ARG 79 234 9 Y 1 A HIS 78 ? A HIS 80 235 9 Y 1 A TYR 79 ? A TYR 81 236 9 Y 1 A SER 80 ? A SER 82 237 9 Y 1 A TYR 81 ? A TYR 83 238 9 Y 1 A SER 82 ? A SER 84 239 9 Y 1 B GLY -1 ? B GLY 1 240 9 Y 1 B ALA 0 ? B ALA 2 241 9 Y 1 B SER 71 ? B SER 73 242 9 Y 1 B LYS 72 ? B LYS 74 243 9 Y 1 B ILE 73 ? B ILE 75 244 9 Y 1 B SER 74 ? B SER 76 245 9 Y 1 B GLU 75 ? B GLU 77 246 9 Y 1 B TYR 76 ? B TYR 78 247 9 Y 1 B ARG 77 ? B ARG 79 248 9 Y 1 B HIS 78 ? B HIS 80 249 9 Y 1 B TYR 79 ? B TYR 81 250 9 Y 1 B SER 80 ? B SER 82 251 9 Y 1 B TYR 81 ? B TYR 83 252 9 Y 1 B SER 82 ? B SER 84 253 10 Y 1 A GLY -1 ? A GLY 1 254 10 Y 1 A ALA 0 ? A ALA 2 255 10 Y 1 A SER 71 ? A SER 73 256 10 Y 1 A LYS 72 ? A LYS 74 257 10 Y 1 A ILE 73 ? A ILE 75 258 10 Y 1 A SER 74 ? A SER 76 259 10 Y 1 A GLU 75 ? A GLU 77 260 10 Y 1 A TYR 76 ? A TYR 78 261 10 Y 1 A ARG 77 ? A ARG 79 262 10 Y 1 A HIS 78 ? A HIS 80 263 10 Y 1 A TYR 79 ? A TYR 81 264 10 Y 1 A SER 80 ? A SER 82 265 10 Y 1 A TYR 81 ? A TYR 83 266 10 Y 1 A SER 82 ? A SER 84 267 10 Y 1 B GLY -1 ? B GLY 1 268 10 Y 1 B ALA 0 ? B ALA 2 269 10 Y 1 B SER 71 ? B SER 73 270 10 Y 1 B LYS 72 ? B LYS 74 271 10 Y 1 B ILE 73 ? B ILE 75 272 10 Y 1 B SER 74 ? B SER 76 273 10 Y 1 B GLU 75 ? B GLU 77 274 10 Y 1 B TYR 76 ? B TYR 78 275 10 Y 1 B ARG 77 ? B ARG 79 276 10 Y 1 B HIS 78 ? B HIS 80 277 10 Y 1 B TYR 79 ? B TYR 81 278 10 Y 1 B SER 80 ? B SER 82 279 10 Y 1 B TYR 81 ? B TYR 83 280 10 Y 1 B SER 82 ? B SER 84 281 11 Y 1 A GLY -1 ? A GLY 1 282 11 Y 1 A ALA 0 ? A ALA 2 283 11 Y 1 A SER 71 ? A SER 73 284 11 Y 1 A LYS 72 ? A LYS 74 285 11 Y 1 A ILE 73 ? A ILE 75 286 11 Y 1 A SER 74 ? A SER 76 287 11 Y 1 A GLU 75 ? A GLU 77 288 11 Y 1 A TYR 76 ? A TYR 78 289 11 Y 1 A ARG 77 ? A ARG 79 290 11 Y 1 A HIS 78 ? A HIS 80 291 11 Y 1 A TYR 79 ? A TYR 81 292 11 Y 1 A SER 80 ? A SER 82 293 11 Y 1 A TYR 81 ? A TYR 83 294 11 Y 1 A SER 82 ? A SER 84 295 11 Y 1 B GLY -1 ? B GLY 1 296 11 Y 1 B ALA 0 ? B ALA 2 297 11 Y 1 B SER 71 ? B SER 73 298 11 Y 1 B LYS 72 ? B LYS 74 299 11 Y 1 B ILE 73 ? B ILE 75 300 11 Y 1 B SER 74 ? B SER 76 301 11 Y 1 B GLU 75 ? B GLU 77 302 11 Y 1 B TYR 76 ? B TYR 78 303 11 Y 1 B ARG 77 ? B ARG 79 304 11 Y 1 B HIS 78 ? B HIS 80 305 11 Y 1 B TYR 79 ? B TYR 81 306 11 Y 1 B SER 80 ? B SER 82 307 11 Y 1 B TYR 81 ? B TYR 83 308 11 Y 1 B SER 82 ? B SER 84 309 12 Y 1 A GLY -1 ? A GLY 1 310 12 Y 1 A ALA 0 ? A ALA 2 311 12 Y 1 A SER 71 ? A SER 73 312 12 Y 1 A LYS 72 ? A LYS 74 313 12 Y 1 A ILE 73 ? A ILE 75 314 12 Y 1 A SER 74 ? A SER 76 315 12 Y 1 A GLU 75 ? A GLU 77 316 12 Y 1 A TYR 76 ? A TYR 78 317 12 Y 1 A ARG 77 ? A ARG 79 318 12 Y 1 A HIS 78 ? A HIS 80 319 12 Y 1 A TYR 79 ? A TYR 81 320 12 Y 1 A SER 80 ? A SER 82 321 12 Y 1 A TYR 81 ? A TYR 83 322 12 Y 1 A SER 82 ? A SER 84 323 12 Y 1 B GLY -1 ? B GLY 1 324 12 Y 1 B ALA 0 ? B ALA 2 325 12 Y 1 B SER 71 ? B SER 73 326 12 Y 1 B LYS 72 ? B LYS 74 327 12 Y 1 B ILE 73 ? B ILE 75 328 12 Y 1 B SER 74 ? B SER 76 329 12 Y 1 B GLU 75 ? B GLU 77 330 12 Y 1 B TYR 76 ? B TYR 78 331 12 Y 1 B ARG 77 ? B ARG 79 332 12 Y 1 B HIS 78 ? B HIS 80 333 12 Y 1 B TYR 79 ? B TYR 81 334 12 Y 1 B SER 80 ? B SER 82 335 12 Y 1 B TYR 81 ? B TYR 83 336 12 Y 1 B SER 82 ? B SER 84 337 13 Y 1 A GLY -1 ? A GLY 1 338 13 Y 1 A ALA 0 ? A ALA 2 339 13 Y 1 A SER 71 ? A SER 73 340 13 Y 1 A LYS 72 ? A LYS 74 341 13 Y 1 A ILE 73 ? A ILE 75 342 13 Y 1 A SER 74 ? A SER 76 343 13 Y 1 A GLU 75 ? A GLU 77 344 13 Y 1 A TYR 76 ? A TYR 78 345 13 Y 1 A ARG 77 ? A ARG 79 346 13 Y 1 A HIS 78 ? A HIS 80 347 13 Y 1 A TYR 79 ? A TYR 81 348 13 Y 1 A SER 80 ? A SER 82 349 13 Y 1 A TYR 81 ? A TYR 83 350 13 Y 1 A SER 82 ? A SER 84 351 13 Y 1 B GLY -1 ? B GLY 1 352 13 Y 1 B ALA 0 ? B ALA 2 353 13 Y 1 B SER 71 ? B SER 73 354 13 Y 1 B LYS 72 ? B LYS 74 355 13 Y 1 B ILE 73 ? B ILE 75 356 13 Y 1 B SER 74 ? B SER 76 357 13 Y 1 B GLU 75 ? B GLU 77 358 13 Y 1 B TYR 76 ? B TYR 78 359 13 Y 1 B ARG 77 ? B ARG 79 360 13 Y 1 B HIS 78 ? B HIS 80 361 13 Y 1 B TYR 79 ? B TYR 81 362 13 Y 1 B SER 80 ? B SER 82 363 13 Y 1 B TYR 81 ? B TYR 83 364 13 Y 1 B SER 82 ? B SER 84 365 14 Y 1 A GLY -1 ? A GLY 1 366 14 Y 1 A ALA 0 ? A ALA 2 367 14 Y 1 A SER 71 ? A SER 73 368 14 Y 1 A LYS 72 ? A LYS 74 369 14 Y 1 A ILE 73 ? A ILE 75 370 14 Y 1 A SER 74 ? A SER 76 371 14 Y 1 A GLU 75 ? A GLU 77 372 14 Y 1 A TYR 76 ? A TYR 78 373 14 Y 1 A ARG 77 ? A ARG 79 374 14 Y 1 A HIS 78 ? A HIS 80 375 14 Y 1 A TYR 79 ? A TYR 81 376 14 Y 1 A SER 80 ? A SER 82 377 14 Y 1 A TYR 81 ? A TYR 83 378 14 Y 1 A SER 82 ? A SER 84 379 14 Y 1 B GLY -1 ? B GLY 1 380 14 Y 1 B ALA 0 ? B ALA 2 381 14 Y 1 B SER 71 ? B SER 73 382 14 Y 1 B LYS 72 ? B LYS 74 383 14 Y 1 B ILE 73 ? B ILE 75 384 14 Y 1 B SER 74 ? B SER 76 385 14 Y 1 B GLU 75 ? B GLU 77 386 14 Y 1 B TYR 76 ? B TYR 78 387 14 Y 1 B ARG 77 ? B ARG 79 388 14 Y 1 B HIS 78 ? B HIS 80 389 14 Y 1 B TYR 79 ? B TYR 81 390 14 Y 1 B SER 80 ? B SER 82 391 14 Y 1 B TYR 81 ? B TYR 83 392 14 Y 1 B SER 82 ? B SER 84 393 15 Y 1 A GLY -1 ? A GLY 1 394 15 Y 1 A ALA 0 ? A ALA 2 395 15 Y 1 A SER 71 ? A SER 73 396 15 Y 1 A LYS 72 ? A LYS 74 397 15 Y 1 A ILE 73 ? A ILE 75 398 15 Y 1 A SER 74 ? A SER 76 399 15 Y 1 A GLU 75 ? A GLU 77 400 15 Y 1 A TYR 76 ? A TYR 78 401 15 Y 1 A ARG 77 ? A ARG 79 402 15 Y 1 A HIS 78 ? A HIS 80 403 15 Y 1 A TYR 79 ? A TYR 81 404 15 Y 1 A SER 80 ? A SER 82 405 15 Y 1 A TYR 81 ? A TYR 83 406 15 Y 1 A SER 82 ? A SER 84 407 15 Y 1 B GLY -1 ? B GLY 1 408 15 Y 1 B ALA 0 ? B ALA 2 409 15 Y 1 B SER 71 ? B SER 73 410 15 Y 1 B LYS 72 ? B LYS 74 411 15 Y 1 B ILE 73 ? B ILE 75 412 15 Y 1 B SER 74 ? B SER 76 413 15 Y 1 B GLU 75 ? B GLU 77 414 15 Y 1 B TYR 76 ? B TYR 78 415 15 Y 1 B ARG 77 ? B ARG 79 416 15 Y 1 B HIS 78 ? B HIS 80 417 15 Y 1 B TYR 79 ? B TYR 81 418 15 Y 1 B SER 80 ? B SER 82 419 15 Y 1 B TYR 81 ? B TYR 83 420 15 Y 1 B SER 82 ? B SER 84 421 16 Y 1 A GLY -1 ? A GLY 1 422 16 Y 1 A ALA 0 ? A ALA 2 423 16 Y 1 A SER 71 ? A SER 73 424 16 Y 1 A LYS 72 ? A LYS 74 425 16 Y 1 A ILE 73 ? A ILE 75 426 16 Y 1 A SER 74 ? A SER 76 427 16 Y 1 A GLU 75 ? A GLU 77 428 16 Y 1 A TYR 76 ? A TYR 78 429 16 Y 1 A ARG 77 ? A ARG 79 430 16 Y 1 A HIS 78 ? A HIS 80 431 16 Y 1 A TYR 79 ? A TYR 81 432 16 Y 1 A SER 80 ? A SER 82 433 16 Y 1 A TYR 81 ? A TYR 83 434 16 Y 1 A SER 82 ? A SER 84 435 16 Y 1 B GLY -1 ? B GLY 1 436 16 Y 1 B ALA 0 ? B ALA 2 437 16 Y 1 B SER 71 ? B SER 73 438 16 Y 1 B LYS 72 ? B LYS 74 439 16 Y 1 B ILE 73 ? B ILE 75 440 16 Y 1 B SER 74 ? B SER 76 441 16 Y 1 B GLU 75 ? B GLU 77 442 16 Y 1 B TYR 76 ? B TYR 78 443 16 Y 1 B ARG 77 ? B ARG 79 444 16 Y 1 B HIS 78 ? B HIS 80 445 16 Y 1 B TYR 79 ? B TYR 81 446 16 Y 1 B SER 80 ? B SER 82 447 16 Y 1 B TYR 81 ? B TYR 83 448 16 Y 1 B SER 82 ? B SER 84 449 17 Y 1 A GLY -1 ? A GLY 1 450 17 Y 1 A ALA 0 ? A ALA 2 451 17 Y 1 A SER 71 ? A SER 73 452 17 Y 1 A LYS 72 ? A LYS 74 453 17 Y 1 A ILE 73 ? A ILE 75 454 17 Y 1 A SER 74 ? A SER 76 455 17 Y 1 A GLU 75 ? A GLU 77 456 17 Y 1 A TYR 76 ? A TYR 78 457 17 Y 1 A ARG 77 ? A ARG 79 458 17 Y 1 A HIS 78 ? A HIS 80 459 17 Y 1 A TYR 79 ? A TYR 81 460 17 Y 1 A SER 80 ? A SER 82 461 17 Y 1 A TYR 81 ? A TYR 83 462 17 Y 1 A SER 82 ? A SER 84 463 17 Y 1 B GLY -1 ? B GLY 1 464 17 Y 1 B ALA 0 ? B ALA 2 465 17 Y 1 B SER 71 ? B SER 73 466 17 Y 1 B LYS 72 ? B LYS 74 467 17 Y 1 B ILE 73 ? B ILE 75 468 17 Y 1 B SER 74 ? B SER 76 469 17 Y 1 B GLU 75 ? B GLU 77 470 17 Y 1 B TYR 76 ? B TYR 78 471 17 Y 1 B ARG 77 ? B ARG 79 472 17 Y 1 B HIS 78 ? B HIS 80 473 17 Y 1 B TYR 79 ? B TYR 81 474 17 Y 1 B SER 80 ? B SER 82 475 17 Y 1 B TYR 81 ? B TYR 83 476 17 Y 1 B SER 82 ? B SER 84 477 18 Y 1 A GLY -1 ? A GLY 1 478 18 Y 1 A ALA 0 ? A ALA 2 479 18 Y 1 A SER 71 ? A SER 73 480 18 Y 1 A LYS 72 ? A LYS 74 481 18 Y 1 A ILE 73 ? A ILE 75 482 18 Y 1 A SER 74 ? A SER 76 483 18 Y 1 A GLU 75 ? A GLU 77 484 18 Y 1 A TYR 76 ? A TYR 78 485 18 Y 1 A ARG 77 ? A ARG 79 486 18 Y 1 A HIS 78 ? A HIS 80 487 18 Y 1 A TYR 79 ? A TYR 81 488 18 Y 1 A SER 80 ? A SER 82 489 18 Y 1 A TYR 81 ? A TYR 83 490 18 Y 1 A SER 82 ? A SER 84 491 18 Y 1 B GLY -1 ? B GLY 1 492 18 Y 1 B ALA 0 ? B ALA 2 493 18 Y 1 B SER 71 ? B SER 73 494 18 Y 1 B LYS 72 ? B LYS 74 495 18 Y 1 B ILE 73 ? B ILE 75 496 18 Y 1 B SER 74 ? B SER 76 497 18 Y 1 B GLU 75 ? B GLU 77 498 18 Y 1 B TYR 76 ? B TYR 78 499 18 Y 1 B ARG 77 ? B ARG 79 500 18 Y 1 B HIS 78 ? B HIS 80 501 18 Y 1 B TYR 79 ? B TYR 81 502 18 Y 1 B SER 80 ? B SER 82 503 18 Y 1 B TYR 81 ? B TYR 83 504 18 Y 1 B SER 82 ? B SER 84 505 19 Y 1 A GLY -1 ? A GLY 1 506 19 Y 1 A ALA 0 ? A ALA 2 507 19 Y 1 A SER 71 ? A SER 73 508 19 Y 1 A LYS 72 ? A LYS 74 509 19 Y 1 A ILE 73 ? A ILE 75 510 19 Y 1 A SER 74 ? A SER 76 511 19 Y 1 A GLU 75 ? A GLU 77 512 19 Y 1 A TYR 76 ? A TYR 78 513 19 Y 1 A ARG 77 ? A ARG 79 514 19 Y 1 A HIS 78 ? A HIS 80 515 19 Y 1 A TYR 79 ? A TYR 81 516 19 Y 1 A SER 80 ? A SER 82 517 19 Y 1 A TYR 81 ? A TYR 83 518 19 Y 1 A SER 82 ? A SER 84 519 19 Y 1 B GLY -1 ? B GLY 1 520 19 Y 1 B ALA 0 ? B ALA 2 521 19 Y 1 B SER 71 ? B SER 73 522 19 Y 1 B LYS 72 ? B LYS 74 523 19 Y 1 B ILE 73 ? B ILE 75 524 19 Y 1 B SER 74 ? B SER 76 525 19 Y 1 B GLU 75 ? B GLU 77 526 19 Y 1 B TYR 76 ? B TYR 78 527 19 Y 1 B ARG 77 ? B ARG 79 528 19 Y 1 B HIS 78 ? B HIS 80 529 19 Y 1 B TYR 79 ? B TYR 81 530 19 Y 1 B SER 80 ? B SER 82 531 19 Y 1 B TYR 81 ? B TYR 83 532 19 Y 1 B SER 82 ? B SER 84 533 20 Y 1 A GLY -1 ? A GLY 1 534 20 Y 1 A ALA 0 ? A ALA 2 535 20 Y 1 A SER 71 ? A SER 73 536 20 Y 1 A LYS 72 ? A LYS 74 537 20 Y 1 A ILE 73 ? A ILE 75 538 20 Y 1 A SER 74 ? A SER 76 539 20 Y 1 A GLU 75 ? A GLU 77 540 20 Y 1 A TYR 76 ? A TYR 78 541 20 Y 1 A ARG 77 ? A ARG 79 542 20 Y 1 A HIS 78 ? A HIS 80 543 20 Y 1 A TYR 79 ? A TYR 81 544 20 Y 1 A SER 80 ? A SER 82 545 20 Y 1 A TYR 81 ? A TYR 83 546 20 Y 1 A SER 82 ? A SER 84 547 20 Y 1 B GLY -1 ? B GLY 1 548 20 Y 1 B ALA 0 ? B ALA 2 549 20 Y 1 B SER 71 ? B SER 73 550 20 Y 1 B LYS 72 ? B LYS 74 551 20 Y 1 B ILE 73 ? B ILE 75 552 20 Y 1 B SER 74 ? B SER 76 553 20 Y 1 B GLU 75 ? B GLU 77 554 20 Y 1 B TYR 76 ? B TYR 78 555 20 Y 1 B ARG 77 ? B ARG 79 556 20 Y 1 B HIS 78 ? B HIS 80 557 20 Y 1 B TYR 79 ? B TYR 81 558 20 Y 1 B SER 80 ? B SER 82 559 20 Y 1 B TYR 81 ? B TYR 83 560 20 Y 1 B SER 82 ? B SER 84 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #