data_2LKB
# 
_entry.id   2LKB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2LKB         pdb_00002lkb 10.2210/pdb2lkb/pdb 
RCSB  RCSB102486   ?            ?                   
BMRB  17988        ?            10.13018/BMR17988   
WWPDB D_1000102486 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-11-02 
2 'Structure model' 1 1 2023-06-14 
3 'Structure model' 1 2 2024-10-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
3 2 'Structure model' Other                 
4 3 'Structure model' 'Data collection'     
5 3 'Structure model' 'Database references' 
6 3 'Structure model' 'Structure summary'   
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' database_2                
2 2 'Structure model' pdbx_database_status      
3 2 'Structure model' pdbx_nmr_software         
4 3 'Structure model' chem_comp_atom            
5 3 'Structure model' chem_comp_bond            
6 3 'Structure model' database_2                
7 3 'Structure model' pdbx_entry_details        
8 3 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_database_2.pdbx_DOI'                       
2 2 'Structure model' '_database_2.pdbx_database_accession'        
3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 
4 2 'Structure model' '_pdbx_nmr_software.name'                    
5 3 'Structure model' '_database_2.pdbx_DOI'                       
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LKB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2011-10-09 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            REL 
_pdbx_database_status.methods_development_category    ? 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          17988 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        . 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhu, S.'      1 
'Peigneur, S.' 2 
'Gao, B.'      3 
'Lu, X.'       4 
'Cao, C.'      5 
'Tytgat, J.'   6 
# 
_citation.id                        primary 
_citation.title                     'Evolutionary diversification of Mesobuthus {alpha}-scorpion toxins affecting sodium channels' 
_citation.journal_abbrev            'Mol.Cell Proteomics' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1535-9484 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21969612 
_citation.pdbx_database_id_DOI      10.1074/mcp.M111.012054 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhu, S.'      1 ? 
primary 'Peigneur, S.' 2 ? 
primary 'Gao, B.'      3 ? 
primary 'Lu, X.'       4 ? 
primary 'Cao, C.'      5 ? 
primary 'Tytgat, J.'   6 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           'Neurotoxin MeuNaTx-5' 
_entity.formula_weight             7187.229 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       ARDAYIAKPHNCVYECFDAFSSYCNGVCTKNGAKSGYCQILGTYGNGCWCIALPDNVPIRIPGKCH 
_entity_poly.pdbx_seq_one_letter_code_can   ARDAYIAKPHNCVYECFDAFSSYCNGVCTKNGAKSGYCQILGTYGNGCWCIALPDNVPIRIPGKCH 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  ARG n 
1 3  ASP n 
1 4  ALA n 
1 5  TYR n 
1 6  ILE n 
1 7  ALA n 
1 8  LYS n 
1 9  PRO n 
1 10 HIS n 
1 11 ASN n 
1 12 CYS n 
1 13 VAL n 
1 14 TYR n 
1 15 GLU n 
1 16 CYS n 
1 17 PHE n 
1 18 ASP n 
1 19 ALA n 
1 20 PHE n 
1 21 SER n 
1 22 SER n 
1 23 TYR n 
1 24 CYS n 
1 25 ASN n 
1 26 GLY n 
1 27 VAL n 
1 28 CYS n 
1 29 THR n 
1 30 LYS n 
1 31 ASN n 
1 32 GLY n 
1 33 ALA n 
1 34 LYS n 
1 35 SER n 
1 36 GLY n 
1 37 TYR n 
1 38 CYS n 
1 39 GLN n 
1 40 ILE n 
1 41 LEU n 
1 42 GLY n 
1 43 THR n 
1 44 TYR n 
1 45 GLY n 
1 46 ASN n 
1 47 GLY n 
1 48 CYS n 
1 49 TRP n 
1 50 CYS n 
1 51 ILE n 
1 52 ALA n 
1 53 LEU n 
1 54 PRO n 
1 55 ASP n 
1 56 ASN n 
1 57 VAL n 
1 58 PRO n 
1 59 ILE n 
1 60 ARG n 
1 61 ILE n 
1 62 PRO n 
1 63 GLY n 
1 64 LYS n 
1 65 CYS n 
1 66 HIS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Lesser Asian scorpion' 
_entity_src_nat.pdbx_organism_scientific   'Mesobuthus eupeus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      34648 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  1  1  ALA ALA A . n 
A 1 2  ARG 2  2  2  ARG ARG A . n 
A 1 3  ASP 3  3  3  ASP ASP A . n 
A 1 4  ALA 4  4  4  ALA ALA A . n 
A 1 5  TYR 5  5  5  TYR TYR A . n 
A 1 6  ILE 6  6  6  ILE ILE A . n 
A 1 7  ALA 7  7  7  ALA ALA A . n 
A 1 8  LYS 8  8  8  LYS LYS A . n 
A 1 9  PRO 9  9  9  PRO PRO A . n 
A 1 10 HIS 10 10 10 HIS HIS A . n 
A 1 11 ASN 11 11 11 ASN ASN A . n 
A 1 12 CYS 12 12 12 CYS CYS A . n 
A 1 13 VAL 13 13 13 VAL VAL A . n 
A 1 14 TYR 14 14 14 TYR TYR A . n 
A 1 15 GLU 15 15 15 GLU GLU A . n 
A 1 16 CYS 16 16 16 CYS CYS A . n 
A 1 17 PHE 17 17 17 PHE PHE A . n 
A 1 18 ASP 18 18 18 ASP ASP A . n 
A 1 19 ALA 19 19 19 ALA ALA A . n 
A 1 20 PHE 20 20 20 PHE PHE A . n 
A 1 21 SER 21 21 21 SER SER A . n 
A 1 22 SER 22 22 22 SER SER A . n 
A 1 23 TYR 23 23 23 TYR TYR A . n 
A 1 24 CYS 24 24 24 CYS CYS A . n 
A 1 25 ASN 25 25 25 ASN ASN A . n 
A 1 26 GLY 26 26 26 GLY GLY A . n 
A 1 27 VAL 27 27 27 VAL VAL A . n 
A 1 28 CYS 28 28 28 CYS CYS A . n 
A 1 29 THR 29 29 29 THR THR A . n 
A 1 30 LYS 30 30 30 LYS LYS A . n 
A 1 31 ASN 31 31 31 ASN ASN A . n 
A 1 32 GLY 32 32 32 GLY GLY A . n 
A 1 33 ALA 33 33 33 ALA ALA A . n 
A 1 34 LYS 34 34 34 LYS LYS A . n 
A 1 35 SER 35 35 35 SER SER A . n 
A 1 36 GLY 36 36 36 GLY GLY A . n 
A 1 37 TYR 37 37 37 TYR TYR A . n 
A 1 38 CYS 38 38 38 CYS CYS A . n 
A 1 39 GLN 39 39 39 GLN GLN A . n 
A 1 40 ILE 40 40 40 ILE ILE A . n 
A 1 41 LEU 41 41 41 LEU LEU A . n 
A 1 42 GLY 42 42 42 GLY GLY A . n 
A 1 43 THR 43 43 43 THR THR A . n 
A 1 44 TYR 44 44 44 TYR TYR A . n 
A 1 45 GLY 45 45 45 GLY GLY A . n 
A 1 46 ASN 46 46 46 ASN ASN A . n 
A 1 47 GLY 47 47 47 GLY GLY A . n 
A 1 48 CYS 48 48 48 CYS CYS A . n 
A 1 49 TRP 49 49 49 TRP TRP A . n 
A 1 50 CYS 50 50 50 CYS CYS A . n 
A 1 51 ILE 51 51 51 ILE ILE A . n 
A 1 52 ALA 52 52 52 ALA ALA A . n 
A 1 53 LEU 53 53 53 LEU LEU A . n 
A 1 54 PRO 54 54 54 PRO PRO A . n 
A 1 55 ASP 55 55 55 ASP ASP A . n 
A 1 56 ASN 56 56 56 ASN ASN A . n 
A 1 57 VAL 57 57 57 VAL VAL A . n 
A 1 58 PRO 58 58 58 PRO PRO A . n 
A 1 59 ILE 59 59 59 ILE ILE A . n 
A 1 60 ARG 60 60 60 ARG ARG A . n 
A 1 61 ILE 61 61 61 ILE ILE A . n 
A 1 62 PRO 62 62 62 PRO PRO A . n 
A 1 63 GLY 63 63 63 GLY GLY A . n 
A 1 64 LYS 64 64 64 LYS LYS A . n 
A 1 65 CYS 65 65 65 CYS CYS A . n 
A 1 66 HIS 66 66 66 HIS HIS A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2LKB 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LKB 
_struct.title                     'Evolutionary diversification of Mesobuthus alpha-scorpion toxins affecting sodium channels' 
_struct.pdbx_model_details        'minimized average structure, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'minimized average' 
# 
_struct_keywords.entry_id        2LKB 
_struct_keywords.pdbx_keywords   TOXIN 
_struct_keywords.text            'Mesobuthus alpha-Scorpion, TOXIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SCXN5_BUTEU 
_struct_ref.pdbx_db_accession          P86405 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ARDAYIAKPHNCVYECFDAFSSYCNGVCTKNGAKSGYCQILGTYGNGCWCIALPDNVPIRIPGKCH 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2LKB 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 66 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P86405 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  66 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       66 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 18 ? SER A 21 ? ASP A 18 SER A 21 5 ? 4 
HELX_P HELX_P2 2 SER A 22 ? LYS A 30 ? SER A 22 LYS A 30 1 ? 9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 65 SG ? ? A CYS 12 A CYS 65 1_555 ? ? ? ? ? ? ? 2.021 ? ? 
disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 16 A CYS 38 1_555 ? ? ? ? ? ? ? 2.021 ? ? 
disulf3 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 24 A CYS 48 1_555 ? ? ? ? ? ? ? 2.021 ? ? 
disulf4 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 28 A CYS 50 1_555 ? ? ? ? ? ? ? 2.021 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 CYS A 12 ? CYS A 65 ? CYS A 12 ? 1_555 CYS A 65 ? 1_555 SG SG . . . None 'Disulfide bridge' 
2 CYS A 16 ? CYS A 38 ? CYS A 16 ? 1_555 CYS A 38 ? 1_555 SG SG . . . None 'Disulfide bridge' 
3 CYS A 24 ? CYS A 48 ? CYS A 24 ? 1_555 CYS A 48 ? 1_555 SG SG . . . None 'Disulfide bridge' 
4 CYS A 28 ? CYS A 50 ? CYS A 28 ? 1_555 CYS A 50 ? 1_555 SG SG . . . None 'Disulfide bridge' 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 35 ? ILE A 40 ? SER A 35 ILE A 40 
A 2 ASN A 46 ? ILE A 51 ? ASN A 46 ILE A 51 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    37 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     37 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   TRP 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    49 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    TRP 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     49 
# 
_pdbx_entry_details.entry_id                   2LKB 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 2  HH21 A ARG 2  ? ? HE1 A TRP 49 ? ? 1.24 
2 5  HH   A TYR 14 ? ? HH  A TYR 23 ? ? 1.26 
3 5  HE   A ARG 2  ? ? HE1 A TRP 49 ? ? 1.32 
4 12 H1   A ALA 1  ? ? H   A VAL 57 ? ? 1.25 
5 14 HE   A ARG 2  ? ? HE1 A TRP 49 ? ? 1.24 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  ALA A 4  ? ? -99.79  -65.00  
2   1  PRO A 9  ? ? -34.02  -110.85 
3   1  GLU A 15 ? ? -175.24 93.13   
4   1  PHE A 17 ? ? -109.67 -152.55 
5   1  ALA A 33 ? ? -174.02 -26.69  
6   1  GLN A 39 ? ? -119.87 -139.88 
7   1  THR A 43 ? ? -103.65 -70.63  
8   1  ALA A 52 ? ? 162.17  168.73  
9   1  PRO A 54 ? ? -49.73  -174.05 
10  1  ASN A 56 ? ? 159.97  -174.80 
11  1  PRO A 62 ? ? -57.40  -0.43   
12  2  ALA A 4  ? ? -106.32 -83.94  
13  2  HIS A 10 ? ? -151.65 -6.80   
14  2  GLU A 15 ? ? 177.14  80.83   
15  2  CYS A 16 ? ? -44.75  156.95  
16  2  PHE A 17 ? ? -132.56 -149.13 
17  2  THR A 43 ? ? -94.82  -72.88  
18  2  ALA A 52 ? ? -174.29 -32.26  
19  2  PRO A 54 ? ? -42.03  -78.78  
20  2  ASP A 55 ? ? -177.03 39.70   
21  2  VAL A 57 ? ? 47.49   70.12   
22  3  ALA A 4  ? ? -105.10 -83.27  
23  3  HIS A 10 ? ? -145.15 -15.31  
24  3  GLU A 15 ? ? -174.29 95.38   
25  3  PHE A 17 ? ? -76.30  -157.07 
26  3  SER A 22 ? ? 150.51  33.24   
27  3  TYR A 23 ? ? -58.43  -71.39  
28  3  ALA A 33 ? ? 179.40  -26.04  
29  3  THR A 43 ? ? 177.55  -40.56  
30  3  ALA A 52 ? ? 179.16  -42.45  
31  3  PRO A 54 ? ? -84.87  33.02   
32  4  ALA A 4  ? ? -108.56 -85.46  
33  4  ASN A 11 ? ? -140.62 -150.70 
34  4  GLU A 15 ? ? -172.15 93.74   
35  4  SER A 22 ? ? 153.12  2.55    
36  4  TYR A 44 ? ? -47.70  -8.58   
37  4  ALA A 52 ? ? -178.52 -43.93  
38  4  VAL A 57 ? ? -37.38  100.24  
39  5  ALA A 4  ? ? -99.50  -69.78  
40  5  GLU A 15 ? ? -175.51 99.51   
41  5  PHE A 17 ? ? -45.62  150.79  
42  5  SER A 21 ? ? 170.06  78.14   
43  5  SER A 22 ? ? -154.45 -66.66  
44  5  GLN A 39 ? ? -120.01 -167.16 
45  5  THR A 43 ? ? -154.55 -81.95  
46  5  ALA A 52 ? ? -158.33 -59.21  
47  5  PRO A 54 ? ? -50.13  -179.82 
48  5  PRO A 62 ? ? -76.51  29.06   
49  6  GLU A 15 ? ? -175.56 96.66   
50  6  PHE A 17 ? ? -108.75 -149.47 
51  6  ALA A 33 ? ? -171.09 -28.48  
52  6  THR A 43 ? ? -97.99  -67.88  
53  6  ALA A 52 ? ? 169.07  147.35  
54  6  PRO A 54 ? ? -84.37  -93.61  
55  7  ALA A 4  ? ? -105.77 -85.46  
56  7  PRO A 9  ? ? -48.63  -76.33  
57  7  GLU A 15 ? ? -174.30 98.44   
58  7  SER A 22 ? ? 155.47  10.64   
59  7  LYS A 34 ? ? -58.46  -71.30  
60  7  THR A 43 ? ? -92.09  -74.07  
61  7  ALA A 52 ? ? -175.39 -56.22  
62  7  VAL A 57 ? ? 32.93   67.63   
63  7  ILE A 59 ? ? 39.93   58.24   
64  8  ALA A 4  ? ? -113.45 -94.25  
65  8  GLU A 15 ? ? -174.76 99.39   
66  8  ASP A 18 ? ? -44.22  107.76  
67  8  SER A 22 ? ? 152.20  26.48   
68  8  THR A 43 ? ? -101.67 -70.44  
69  8  ALA A 52 ? ? -169.66 -76.55  
70  8  VAL A 57 ? ? -38.15  100.42  
71  8  PRO A 62 ? ? -59.79  1.22    
72  9  ALA A 4  ? ? -110.50 -93.48  
73  9  GLU A 15 ? ? -175.90 100.22  
74  9  CYS A 16 ? ? -68.38  93.37   
75  9  ASP A 18 ? ? -153.49 89.45   
76  9  SER A 22 ? ? 153.57  3.83    
77  9  TYR A 23 ? ? -57.08  -79.89  
78  9  LYS A 34 ? ? -56.24  -71.63  
79  9  GLN A 39 ? ? -140.30 -138.53 
80  9  THR A 43 ? ? -100.52 -99.04  
81  9  ALA A 52 ? ? -171.18 -55.24  
82  10 ALA A 4  ? ? -100.28 -81.67  
83  10 PRO A 9  ? ? -34.16  -109.62 
84  10 GLU A 15 ? ? -167.61 95.00   
85  10 ALA A 33 ? ? 161.45  -12.37  
86  10 THR A 43 ? ? -94.14  -120.88 
87  10 ALA A 52 ? ? -168.91 -40.57  
88  10 PRO A 54 ? ? -42.55  -72.39  
89  10 ASP A 55 ? ? -175.37 47.83   
90  10 PRO A 62 ? ? -46.64  -5.90   
91  10 CYS A 65 ? ? 51.64   -84.98  
92  11 ALA A 4  ? ? -99.60  -78.31  
93  11 GLU A 15 ? ? 55.90   97.59   
94  11 SER A 21 ? ? 168.98  86.78   
95  11 SER A 22 ? ? -170.24 -64.52  
96  11 ALA A 52 ? ? -177.11 -66.70  
97  11 VAL A 57 ? ? -33.85  97.84   
98  11 CYS A 65 ? ? 57.12   -77.62  
99  12 ALA A 4  ? ? -109.86 -92.52  
100 12 HIS A 10 ? ? -147.64 -5.99   
101 12 GLU A 15 ? ? -175.29 99.30   
102 12 PHE A 17 ? ? -122.12 -161.14 
103 12 LYS A 34 ? ? -57.91  -76.04  
104 12 THR A 43 ? ? -157.44 -81.67  
105 12 ALA A 52 ? ? -179.07 -146.01 
106 12 LEU A 53 ? ? 176.43  -44.71  
107 12 CYS A 65 ? ? 58.46   -74.98  
108 13 ALA A 4  ? ? -103.08 -81.42  
109 13 HIS A 10 ? ? -149.65 12.08   
110 13 GLU A 15 ? ? -174.56 99.31   
111 13 SER A 21 ? ? 168.97  78.62   
112 13 SER A 22 ? ? -156.01 -66.94  
113 13 ASP A 55 ? ? -154.99 -71.02  
114 13 ASN A 56 ? ? -173.39 29.95   
115 13 PRO A 62 ? ? -72.83  23.91   
116 14 ALA A 4  ? ? -99.83  -79.74  
117 14 GLU A 15 ? ? -151.19 89.38   
118 14 CYS A 16 ? ? -59.21  109.49  
119 14 ASP A 18 ? ? -43.54  106.39  
120 14 SER A 22 ? ? 151.49  12.30   
121 14 TYR A 23 ? ? -57.35  -71.62  
122 14 ALA A 33 ? ? -172.10 -26.70  
123 14 TYR A 44 ? ? -46.48  -12.59  
124 14 ALA A 52 ? ? -159.59 -28.91  
125 14 PRO A 54 ? ? -49.72  -0.63   
126 14 ASP A 55 ? ? 89.90   49.80   
127 14 PRO A 62 ? ? -58.28  5.99    
128 15 ALA A 4  ? ? -99.34  -65.64  
129 15 GLU A 15 ? ? -174.68 99.66   
130 15 PHE A 20 ? ? 49.25   7.53    
131 15 SER A 21 ? ? 173.30  -54.07  
132 15 SER A 22 ? ? 160.98  45.60   
133 15 ALA A 33 ? ? 174.52  -21.28  
134 15 TYR A 44 ? ? -44.65  -16.19  
135 15 ALA A 52 ? ? 90.89   65.47   
136 15 ARG A 60 ? ? -153.95 -33.17  
137 15 PRO A 62 ? ? -53.82  -6.86   
138 16 ALA A 4  ? ? -99.35  -76.67  
139 16 GLU A 15 ? ? -175.95 97.86   
140 16 PHE A 17 ? ? -120.67 -153.75 
141 16 ALA A 33 ? ? 176.77  -25.96  
142 16 THR A 43 ? ? -96.07  -125.16 
143 16 ALA A 52 ? ? 176.19  -22.61  
144 16 PRO A 54 ? ? -38.08  158.25  
145 16 ASN A 56 ? ? -147.86 -47.45  
146 16 PRO A 58 ? ? -79.76  -100.25 
147 16 CYS A 65 ? ? 56.43   -0.61   
148 17 ALA A 4  ? ? -109.93 -83.25  
149 17 GLU A 15 ? ? -177.38 91.78   
150 17 CYS A 16 ? ? -54.12  97.74   
151 17 SER A 22 ? ? 72.48   39.25   
152 17 ALA A 52 ? ? -173.09 -130.13 
153 17 CYS A 65 ? ? 54.80   -81.21  
154 18 ALA A 4  ? ? -108.25 -83.55  
155 18 GLU A 15 ? ? -175.32 98.34   
156 18 PHE A 17 ? ? -119.30 -154.30 
157 18 ALA A 33 ? ? -174.92 -26.84  
158 18 GLN A 39 ? ? -111.11 -162.05 
159 18 THR A 43 ? ? -97.57  -124.12 
160 18 ALA A 52 ? ? -170.96 -52.05  
161 18 PRO A 54 ? ? -54.03  171.03  
162 18 ASP A 55 ? ? 59.88   146.50  
163 18 ARG A 60 ? ? 55.24   1.53    
164 19 ALA A 4  ? ? -106.81 -82.88  
165 19 GLU A 15 ? ? -172.15 98.88   
166 19 SER A 21 ? ? 172.93  73.54   
167 19 SER A 22 ? ? -152.94 -50.47  
168 19 LYS A 34 ? ? -78.62  -77.41  
169 19 GLN A 39 ? ? -141.07 -136.54 
170 19 THR A 43 ? ? -105.66 -63.44  
171 19 ALA A 52 ? ? -170.56 -104.34 
172 19 VAL A 57 ? ? -39.72  102.38  
173 19 ILE A 59 ? ? 39.75   60.56   
174 20 ALA A 4  ? ? -106.07 -84.45  
175 20 HIS A 10 ? ? -141.80 -3.97   
176 20 TYR A 14 ? ? -91.29  -61.26  
177 20 GLU A 15 ? ? -173.89 98.72   
178 20 CYS A 16 ? ? -50.62  103.24  
179 20 ALA A 52 ? ? -179.57 -145.82 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LKB 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LKB 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
_pdbx_nmr_sample_details.contents         '50 mM sodium phosphate-1, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_exptl_sample.component             'sodium phosphate-1' 
_pdbx_nmr_exptl_sample.concentration         50 
_pdbx_nmr_exptl_sample.concentration_range   ? 
_pdbx_nmr_exptl_sample.concentration_units   mM 
_pdbx_nmr_exptl_sample.isotopic_labeling     ? 
_pdbx_nmr_exptl_sample.solution_id           1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.05 
_pdbx_nmr_exptl_sample_conditions.pH                  4.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-1H TOCSY' 
1 2 1 '2D 1H-1H NOESY' 
1 3 1 '2D DQF-COSY'    
# 
_pdbx_nmr_constraints.disulfide_bond_constraints_total_count        ? 
_pdbx_nmr_constraints.entry_id                                      2LKB 
_pdbx_nmr_constraints.hydrogen_bond_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_beta-angle_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_chi-angle_constraints_total_count          ? 
_pdbx_nmr_constraints.NA_delta-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count      ? 
_pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_other-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count       ? 
_pdbx_nmr_constraints.NOE_constraints_total                         710 
_pdbx_nmr_constraints.NOE_interentity_total_count                   ? 
_pdbx_nmr_constraints.NOE_interproton_distance_evaluation           ? 
_pdbx_nmr_constraints.NOE_intraresidue_total_count                  216 
_pdbx_nmr_constraints.NOE_long_range_total_count                    117 
_pdbx_nmr_constraints.NOE_medium_range_total_count                  122 
_pdbx_nmr_constraints.NOE_motional_averaging_correction             ? 
_pdbx_nmr_constraints.NOE_pseudoatom_corrections                    ? 
_pdbx_nmr_constraints.NOE_sequential_total_count                    255 
_pdbx_nmr_constraints.protein_chi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_other_angle_constraints_total_count   ? 
_pdbx_nmr_constraints.protein_phi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_psi_angle_constraints_total_count     ? 
# 
_pdbx_nmr_refine.entry_id           2LKB 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_software.authors          Brunger 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             'X-PLOR NIH' 
_pdbx_nmr_software.ordinal          1 
_pdbx_nmr_software.version          ? 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
PHE N    N N N 227 
PHE CA   C N S 228 
PHE C    C N N 229 
PHE O    O N N 230 
PHE CB   C N N 231 
PHE CG   C Y N 232 
PHE CD1  C Y N 233 
PHE CD2  C Y N 234 
PHE CE1  C Y N 235 
PHE CE2  C Y N 236 
PHE CZ   C Y N 237 
PHE OXT  O N N 238 
PHE H    H N N 239 
PHE H2   H N N 240 
PHE HA   H N N 241 
PHE HB2  H N N 242 
PHE HB3  H N N 243 
PHE HD1  H N N 244 
PHE HD2  H N N 245 
PHE HE1  H N N 246 
PHE HE2  H N N 247 
PHE HZ   H N N 248 
PHE HXT  H N N 249 
PRO N    N N N 250 
PRO CA   C N S 251 
PRO C    C N N 252 
PRO O    O N N 253 
PRO CB   C N N 254 
PRO CG   C N N 255 
PRO CD   C N N 256 
PRO OXT  O N N 257 
PRO H    H N N 258 
PRO HA   H N N 259 
PRO HB2  H N N 260 
PRO HB3  H N N 261 
PRO HG2  H N N 262 
PRO HG3  H N N 263 
PRO HD2  H N N 264 
PRO HD3  H N N 265 
PRO HXT  H N N 266 
SER N    N N N 267 
SER CA   C N S 268 
SER C    C N N 269 
SER O    O N N 270 
SER CB   C N N 271 
SER OG   O N N 272 
SER OXT  O N N 273 
SER H    H N N 274 
SER H2   H N N 275 
SER HA   H N N 276 
SER HB2  H N N 277 
SER HB3  H N N 278 
SER HG   H N N 279 
SER HXT  H N N 280 
THR N    N N N 281 
THR CA   C N S 282 
THR C    C N N 283 
THR O    O N N 284 
THR CB   C N R 285 
THR OG1  O N N 286 
THR CG2  C N N 287 
THR OXT  O N N 288 
THR H    H N N 289 
THR H2   H N N 290 
THR HA   H N N 291 
THR HB   H N N 292 
THR HG1  H N N 293 
THR HG21 H N N 294 
THR HG22 H N N 295 
THR HG23 H N N 296 
THR HXT  H N N 297 
TRP N    N N N 298 
TRP CA   C N S 299 
TRP C    C N N 300 
TRP O    O N N 301 
TRP CB   C N N 302 
TRP CG   C Y N 303 
TRP CD1  C Y N 304 
TRP CD2  C Y N 305 
TRP NE1  N Y N 306 
TRP CE2  C Y N 307 
TRP CE3  C Y N 308 
TRP CZ2  C Y N 309 
TRP CZ3  C Y N 310 
TRP CH2  C Y N 311 
TRP OXT  O N N 312 
TRP H    H N N 313 
TRP H2   H N N 314 
TRP HA   H N N 315 
TRP HB2  H N N 316 
TRP HB3  H N N 317 
TRP HD1  H N N 318 
TRP HE1  H N N 319 
TRP HE3  H N N 320 
TRP HZ2  H N N 321 
TRP HZ3  H N N 322 
TRP HH2  H N N 323 
TRP HXT  H N N 324 
TYR N    N N N 325 
TYR CA   C N S 326 
TYR C    C N N 327 
TYR O    O N N 328 
TYR CB   C N N 329 
TYR CG   C Y N 330 
TYR CD1  C Y N 331 
TYR CD2  C Y N 332 
TYR CE1  C Y N 333 
TYR CE2  C Y N 334 
TYR CZ   C Y N 335 
TYR OH   O N N 336 
TYR OXT  O N N 337 
TYR H    H N N 338 
TYR H2   H N N 339 
TYR HA   H N N 340 
TYR HB2  H N N 341 
TYR HB3  H N N 342 
TYR HD1  H N N 343 
TYR HD2  H N N 344 
TYR HE1  H N N 345 
TYR HE2  H N N 346 
TYR HH   H N N 347 
TYR HXT  H N N 348 
VAL N    N N N 349 
VAL CA   C N S 350 
VAL C    C N N 351 
VAL O    O N N 352 
VAL CB   C N N 353 
VAL CG1  C N N 354 
VAL CG2  C N N 355 
VAL OXT  O N N 356 
VAL H    H N N 357 
VAL H2   H N N 358 
VAL HA   H N N 359 
VAL HB   H N N 360 
VAL HG11 H N N 361 
VAL HG12 H N N 362 
VAL HG13 H N N 363 
VAL HG21 H N N 364 
VAL HG22 H N N 365 
VAL HG23 H N N 366 
VAL HXT  H N N 367 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
PHE N   CA   sing N N 216 
PHE N   H    sing N N 217 
PHE N   H2   sing N N 218 
PHE CA  C    sing N N 219 
PHE CA  CB   sing N N 220 
PHE CA  HA   sing N N 221 
PHE C   O    doub N N 222 
PHE C   OXT  sing N N 223 
PHE CB  CG   sing N N 224 
PHE CB  HB2  sing N N 225 
PHE CB  HB3  sing N N 226 
PHE CG  CD1  doub Y N 227 
PHE CG  CD2  sing Y N 228 
PHE CD1 CE1  sing Y N 229 
PHE CD1 HD1  sing N N 230 
PHE CD2 CE2  doub Y N 231 
PHE CD2 HD2  sing N N 232 
PHE CE1 CZ   doub Y N 233 
PHE CE1 HE1  sing N N 234 
PHE CE2 CZ   sing Y N 235 
PHE CE2 HE2  sing N N 236 
PHE CZ  HZ   sing N N 237 
PHE OXT HXT  sing N N 238 
PRO N   CA   sing N N 239 
PRO N   CD   sing N N 240 
PRO N   H    sing N N 241 
PRO CA  C    sing N N 242 
PRO CA  CB   sing N N 243 
PRO CA  HA   sing N N 244 
PRO C   O    doub N N 245 
PRO C   OXT  sing N N 246 
PRO CB  CG   sing N N 247 
PRO CB  HB2  sing N N 248 
PRO CB  HB3  sing N N 249 
PRO CG  CD   sing N N 250 
PRO CG  HG2  sing N N 251 
PRO CG  HG3  sing N N 252 
PRO CD  HD2  sing N N 253 
PRO CD  HD3  sing N N 254 
PRO OXT HXT  sing N N 255 
SER N   CA   sing N N 256 
SER N   H    sing N N 257 
SER N   H2   sing N N 258 
SER CA  C    sing N N 259 
SER CA  CB   sing N N 260 
SER CA  HA   sing N N 261 
SER C   O    doub N N 262 
SER C   OXT  sing N N 263 
SER CB  OG   sing N N 264 
SER CB  HB2  sing N N 265 
SER CB  HB3  sing N N 266 
SER OG  HG   sing N N 267 
SER OXT HXT  sing N N 268 
THR N   CA   sing N N 269 
THR N   H    sing N N 270 
THR N   H2   sing N N 271 
THR CA  C    sing N N 272 
THR CA  CB   sing N N 273 
THR CA  HA   sing N N 274 
THR C   O    doub N N 275 
THR C   OXT  sing N N 276 
THR CB  OG1  sing N N 277 
THR CB  CG2  sing N N 278 
THR CB  HB   sing N N 279 
THR OG1 HG1  sing N N 280 
THR CG2 HG21 sing N N 281 
THR CG2 HG22 sing N N 282 
THR CG2 HG23 sing N N 283 
THR OXT HXT  sing N N 284 
TRP N   CA   sing N N 285 
TRP N   H    sing N N 286 
TRP N   H2   sing N N 287 
TRP CA  C    sing N N 288 
TRP CA  CB   sing N N 289 
TRP CA  HA   sing N N 290 
TRP C   O    doub N N 291 
TRP C   OXT  sing N N 292 
TRP CB  CG   sing N N 293 
TRP CB  HB2  sing N N 294 
TRP CB  HB3  sing N N 295 
TRP CG  CD1  doub Y N 296 
TRP CG  CD2  sing Y N 297 
TRP CD1 NE1  sing Y N 298 
TRP CD1 HD1  sing N N 299 
TRP CD2 CE2  doub Y N 300 
TRP CD2 CE3  sing Y N 301 
TRP NE1 CE2  sing Y N 302 
TRP NE1 HE1  sing N N 303 
TRP CE2 CZ2  sing Y N 304 
TRP CE3 CZ3  doub Y N 305 
TRP CE3 HE3  sing N N 306 
TRP CZ2 CH2  doub Y N 307 
TRP CZ2 HZ2  sing N N 308 
TRP CZ3 CH2  sing Y N 309 
TRP CZ3 HZ3  sing N N 310 
TRP CH2 HH2  sing N N 311 
TRP OXT HXT  sing N N 312 
TYR N   CA   sing N N 313 
TYR N   H    sing N N 314 
TYR N   H2   sing N N 315 
TYR CA  C    sing N N 316 
TYR CA  CB   sing N N 317 
TYR CA  HA   sing N N 318 
TYR C   O    doub N N 319 
TYR C   OXT  sing N N 320 
TYR CB  CG   sing N N 321 
TYR CB  HB2  sing N N 322 
TYR CB  HB3  sing N N 323 
TYR CG  CD1  doub Y N 324 
TYR CG  CD2  sing Y N 325 
TYR CD1 CE1  sing Y N 326 
TYR CD1 HD1  sing N N 327 
TYR CD2 CE2  doub Y N 328 
TYR CD2 HD2  sing N N 329 
TYR CE1 CZ   doub Y N 330 
TYR CE1 HE1  sing N N 331 
TYR CE2 CZ   sing Y N 332 
TYR CE2 HE2  sing N N 333 
TYR CZ  OH   sing N N 334 
TYR OH  HH   sing N N 335 
TYR OXT HXT  sing N N 336 
VAL N   CA   sing N N 337 
VAL N   H    sing N N 338 
VAL N   H2   sing N N 339 
VAL CA  C    sing N N 340 
VAL CA  CB   sing N N 341 
VAL CA  HA   sing N N 342 
VAL C   O    doub N N 343 
VAL C   OXT  sing N N 344 
VAL CB  CG1  sing N N 345 
VAL CB  CG2  sing N N 346 
VAL CB  HB   sing N N 347 
VAL CG1 HG11 sing N N 348 
VAL CG1 HG12 sing N N 349 
VAL CG1 HG13 sing N N 350 
VAL CG2 HG21 sing N N 351 
VAL CG2 HG22 sing N N 352 
VAL CG2 HG23 sing N N 353 
VAL OXT HXT  sing N N 354 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Varian INOVA' 
# 
_atom_sites.entry_id                    2LKB 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_