data_2LKI # _entry.id 2LKI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LKI pdb_00002lki 10.2210/pdb2lki/pdb RCSB RCSB102492 ? ? BMRB 17995 ? ? WWPDB D_1000102492 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2011-11-16 _pdbx_database_PDB_obs_spr.pdb_id 2LKI _pdbx_database_PDB_obs_spr.replace_pdb_id 2AMW _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17995 BMRB unspecified . NET1 TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LKI _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-10-11 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lemak, A.' 1 'Srisailam, S.' 2 'Lukin, J.' 3 'Yee, A.' 4 'Montecchio, M.' 5 'Semesi, A.' 6 'Arrowsmith, C.' 7 'Northeast Structural Genomics Consortium (NESG)' 8 # _citation.id primary _citation.title 'Solution structure of acyl carrier protein from Nitrosomonas Europaea' _citation.journal_abbrev Proteins _citation.journal_volume 64 _citation.page_first 800 _citation.page_last ? _citation.year 2006 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16741959 _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Srisailam, S.' 1 ? primary 'Lukin, J.' 2 ? primary 'Yee, A.' 3 ? primary 'Semesi, A.' 4 ? primary 'Arrowsmith, C.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative uncharacterized protein' 11747.030 1 ? ? ? ? 2 non-polymer syn "4'-PHOSPHOPANTETHEINE" 358.348 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGRENLYFQGHMQHLEAVRNILGDVLNLGERKHTLTASSVLLGNIPELDSMAVVNVITALEEYFDFSVD DDEISAQTFETLGSLALFVEHKLSH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGRENLYFQGHMQHLEAVRNILGDVLNLGERKHTLTASSVLLGNIPELDSMAVVNVITALEEYFDFSVD DDEISAQTFETLGSLALFVEHKLSH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NET1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 ARG n 1 15 GLU n 1 16 ASN n 1 17 LEU n 1 18 TYR n 1 19 PHE n 1 20 GLN n 1 21 GLY n 1 22 HIS n 1 23 MET n 1 24 GLN n 1 25 HIS n 1 26 LEU n 1 27 GLU n 1 28 ALA n 1 29 VAL n 1 30 ARG n 1 31 ASN n 1 32 ILE n 1 33 LEU n 1 34 GLY n 1 35 ASP n 1 36 VAL n 1 37 LEU n 1 38 ASN n 1 39 LEU n 1 40 GLY n 1 41 GLU n 1 42 ARG n 1 43 LYS n 1 44 HIS n 1 45 THR n 1 46 LEU n 1 47 THR n 1 48 ALA n 1 49 SER n 1 50 SER n 1 51 VAL n 1 52 LEU n 1 53 LEU n 1 54 GLY n 1 55 ASN n 1 56 ILE n 1 57 PRO n 1 58 GLU n 1 59 LEU n 1 60 ASP n 1 61 SER n 1 62 MET n 1 63 ALA n 1 64 VAL n 1 65 VAL n 1 66 ASN n 1 67 VAL n 1 68 ILE n 1 69 THR n 1 70 ALA n 1 71 LEU n 1 72 GLU n 1 73 GLU n 1 74 TYR n 1 75 PHE n 1 76 ASP n 1 77 PHE n 1 78 SER n 1 79 VAL n 1 80 ASP n 1 81 ASP n 1 82 ASP n 1 83 GLU n 1 84 ILE n 1 85 SER n 1 86 ALA n 1 87 GLN n 1 88 THR n 1 89 PHE n 1 90 GLU n 1 91 THR n 1 92 LEU n 1 93 GLY n 1 94 SER n 1 95 LEU n 1 96 ALA n 1 97 LEU n 1 98 PHE n 1 99 VAL n 1 100 GLU n 1 101 HIS n 1 102 LYS n 1 103 LEU n 1 104 SER n 1 105 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene NE2163 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Nitrosomonas europaea' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 915 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q82SY3_NITEU _struct_ref.pdbx_db_accession Q82SY3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MQHLEAVRNILGDVLNLGERKHTLTASSVLLGNIPELDSMAVVNVITALEEYFDFSVDDDEISAQTFETLGSLALFVEHK LSH ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LKI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 23 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 105 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q82SY3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 83 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 83 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LKI MET A 1 ? UNP Q82SY3 ? ? 'expression tag' -21 1 1 2LKI GLY A 2 ? UNP Q82SY3 ? ? 'expression tag' -20 2 1 2LKI SER A 3 ? UNP Q82SY3 ? ? 'expression tag' -19 3 1 2LKI SER A 4 ? UNP Q82SY3 ? ? 'expression tag' -18 4 1 2LKI HIS A 5 ? UNP Q82SY3 ? ? 'expression tag' -17 5 1 2LKI HIS A 6 ? UNP Q82SY3 ? ? 'expression tag' -16 6 1 2LKI HIS A 7 ? UNP Q82SY3 ? ? 'expression tag' -15 7 1 2LKI HIS A 8 ? UNP Q82SY3 ? ? 'expression tag' -14 8 1 2LKI HIS A 9 ? UNP Q82SY3 ? ? 'expression tag' -13 9 1 2LKI HIS A 10 ? UNP Q82SY3 ? ? 'expression tag' -12 10 1 2LKI SER A 11 ? UNP Q82SY3 ? ? 'expression tag' -11 11 1 2LKI SER A 12 ? UNP Q82SY3 ? ? 'expression tag' -10 12 1 2LKI GLY A 13 ? UNP Q82SY3 ? ? 'expression tag' -9 13 1 2LKI ARG A 14 ? UNP Q82SY3 ? ? 'expression tag' -8 14 1 2LKI GLU A 15 ? UNP Q82SY3 ? ? 'expression tag' -7 15 1 2LKI ASN A 16 ? UNP Q82SY3 ? ? 'expression tag' -6 16 1 2LKI LEU A 17 ? UNP Q82SY3 ? ? 'expression tag' -5 17 1 2LKI TYR A 18 ? UNP Q82SY3 ? ? 'expression tag' -4 18 1 2LKI PHE A 19 ? UNP Q82SY3 ? ? 'expression tag' -3 19 1 2LKI GLN A 20 ? UNP Q82SY3 ? ? 'expression tag' -2 20 1 2LKI GLY A 21 ? UNP Q82SY3 ? ? 'expression tag' -1 21 1 2LKI HIS A 22 ? UNP Q82SY3 ? ? 'expression tag' 0 22 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PNS non-polymer . "4'-PHOSPHOPANTETHEINE" ? 'C11 H23 N2 O7 P S' 358.348 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCO' 1 2 1 '3D HNCA' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HBHA(CO)NH' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY aliphatic' 1 9 1 '3D 1H-13C NOESY aromatic' 1 10 1 '3D HNCACB' 1 11 1 '3D C(CO)NH' 1 12 1 '3D H(CCO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 450 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;1.0 mM [U-13C; U-15N] protein, 10 mM MOPS, 450 mM sodium chloride, 10 uM ZnSO4, 10 mM DTT, 0.01 % NaN3, 1 mM benzamidine, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LKI _pdbx_nmr_refine.method 'restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LKI _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LKI _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 Goddard 'peak picking' Sparky ? 2 'Lemak,Steren,Llinas, Arrowsmith' 'chemical shift assignment' FMC ? 3 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 4 'Bhattacharya and Montelione' validation PSVS ? 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 6 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LKI _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LKI _struct.title ;Solution NMR structure of holo acyl carrier protein NE2163 from nitrosomonas europaea. Northeast structural genomics consortium target NET1. ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LKI _struct_keywords.pdbx_keywords 'LIPID TRANSPORT' _struct_keywords.text ;helical bundle, acyl carrier, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, PSI-Biology, Protein Structure Initiative, NESG, Northeast structural genomics consortium, LIPID TRANSPORT ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 25 ? LEU A 37 ? HIS A 3 LEU A 15 1 ? 13 HELX_P HELX_P2 2 GLU A 41 ? THR A 45 ? GLU A 19 THR A 23 5 ? 5 HELX_P HELX_P3 3 ASP A 60 ? ASP A 76 ? ASP A 38 ASP A 54 1 ? 17 HELX_P HELX_P4 4 ASP A 80 ? ILE A 84 ? ASP A 58 ILE A 62 5 ? 5 HELX_P HELX_P5 5 SER A 85 ? GLU A 90 ? SER A 63 GLU A 68 5 ? 6 HELX_P HELX_P6 6 THR A 91 ? LEU A 103 ? THR A 69 LEU A 81 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 61 _struct_conn.ptnr1_label_atom_id OG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id PNS _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id P24 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 39 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id PNS _struct_conn.ptnr2_auth_seq_id 84 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.614 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id PNS _struct_site.pdbx_auth_seq_id 84 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'BINDING SITE FOR RESIDUE PNS A 84' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 SER A 61 ? SER A 39 . ? 1_555 ? 2 AC1 8 MET A 62 ? MET A 40 . ? 1_555 ? 3 AC1 8 VAL A 64 ? VAL A 42 . ? 1_555 ? 4 AC1 8 VAL A 65 ? VAL A 43 . ? 1_555 ? 5 AC1 8 ILE A 68 ? ILE A 46 . ? 1_555 ? 6 AC1 8 ILE A 84 ? ILE A 62 . ? 1_555 ? 7 AC1 8 SER A 85 ? SER A 63 . ? 1_555 ? 8 AC1 8 ALA A 86 ? ALA A 64 . ? 1_555 ? # _atom_sites.entry_id 2LKI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -21 ? ? ? A . n A 1 2 GLY 2 -20 ? ? ? A . n A 1 3 SER 3 -19 ? ? ? A . n A 1 4 SER 4 -18 ? ? ? A . n A 1 5 HIS 5 -17 ? ? ? A . n A 1 6 HIS 6 -16 ? ? ? A . n A 1 7 HIS 7 -15 ? ? ? A . n A 1 8 HIS 8 -14 ? ? ? A . n A 1 9 HIS 9 -13 ? ? ? A . n A 1 10 HIS 10 -12 ? ? ? A . n A 1 11 SER 11 -11 ? ? ? A . n A 1 12 SER 12 -10 ? ? ? A . n A 1 13 GLY 13 -9 ? ? ? A . n A 1 14 ARG 14 -8 ? ? ? A . n A 1 15 GLU 15 -7 ? ? ? A . n A 1 16 ASN 16 -6 ? ? ? A . n A 1 17 LEU 17 -5 ? ? ? A . n A 1 18 TYR 18 -4 ? ? ? A . n A 1 19 PHE 19 -3 ? ? ? A . n A 1 20 GLN 20 -2 ? ? ? A . n A 1 21 GLY 21 -1 ? ? ? A . n A 1 22 HIS 22 0 ? ? ? A . n A 1 23 MET 23 1 1 MET MET A . n A 1 24 GLN 24 2 2 GLN GLN A . n A 1 25 HIS 25 3 3 HIS HIS A . n A 1 26 LEU 26 4 4 LEU LEU A . n A 1 27 GLU 27 5 5 GLU GLU A . n A 1 28 ALA 28 6 6 ALA ALA A . n A 1 29 VAL 29 7 7 VAL VAL A . n A 1 30 ARG 30 8 8 ARG ARG A . n A 1 31 ASN 31 9 9 ASN ASN A . n A 1 32 ILE 32 10 10 ILE ILE A . n A 1 33 LEU 33 11 11 LEU LEU A . n A 1 34 GLY 34 12 12 GLY GLY A . n A 1 35 ASP 35 13 13 ASP ASP A . n A 1 36 VAL 36 14 14 VAL VAL A . n A 1 37 LEU 37 15 15 LEU LEU A . n A 1 38 ASN 38 16 16 ASN ASN A . n A 1 39 LEU 39 17 17 LEU LEU A . n A 1 40 GLY 40 18 18 GLY GLY A . n A 1 41 GLU 41 19 19 GLU GLU A . n A 1 42 ARG 42 20 20 ARG ARG A . n A 1 43 LYS 43 21 21 LYS LYS A . n A 1 44 HIS 44 22 22 HIS HIS A . n A 1 45 THR 45 23 23 THR THR A . n A 1 46 LEU 46 24 24 LEU LEU A . n A 1 47 THR 47 25 25 THR THR A . n A 1 48 ALA 48 26 26 ALA ALA A . n A 1 49 SER 49 27 27 SER SER A . n A 1 50 SER 50 28 28 SER SER A . n A 1 51 VAL 51 29 29 VAL VAL A . n A 1 52 LEU 52 30 30 LEU LEU A . n A 1 53 LEU 53 31 31 LEU LEU A . n A 1 54 GLY 54 32 32 GLY GLY A . n A 1 55 ASN 55 33 33 ASN ASN A . n A 1 56 ILE 56 34 34 ILE ILE A . n A 1 57 PRO 57 35 35 PRO PRO A . n A 1 58 GLU 58 36 36 GLU GLU A . n A 1 59 LEU 59 37 37 LEU LEU A . n A 1 60 ASP 60 38 38 ASP ASP A . n A 1 61 SER 61 39 39 SER SER A . n A 1 62 MET 62 40 40 MET MET A . n A 1 63 ALA 63 41 41 ALA ALA A . n A 1 64 VAL 64 42 42 VAL VAL A . n A 1 65 VAL 65 43 43 VAL VAL A . n A 1 66 ASN 66 44 44 ASN ASN A . n A 1 67 VAL 67 45 45 VAL VAL A . n A 1 68 ILE 68 46 46 ILE ILE A . n A 1 69 THR 69 47 47 THR THR A . n A 1 70 ALA 70 48 48 ALA ALA A . n A 1 71 LEU 71 49 49 LEU LEU A . n A 1 72 GLU 72 50 50 GLU GLU A . n A 1 73 GLU 73 51 51 GLU GLU A . n A 1 74 TYR 74 52 52 TYR TYR A . n A 1 75 PHE 75 53 53 PHE PHE A . n A 1 76 ASP 76 54 54 ASP ASP A . n A 1 77 PHE 77 55 55 PHE PHE A . n A 1 78 SER 78 56 56 SER SER A . n A 1 79 VAL 79 57 57 VAL VAL A . n A 1 80 ASP 80 58 58 ASP ASP A . n A 1 81 ASP 81 59 59 ASP ASP A . n A 1 82 ASP 82 60 60 ASP ASP A . n A 1 83 GLU 83 61 61 GLU GLU A . n A 1 84 ILE 84 62 62 ILE ILE A . n A 1 85 SER 85 63 63 SER SER A . n A 1 86 ALA 86 64 64 ALA ALA A . n A 1 87 GLN 87 65 65 GLN GLN A . n A 1 88 THR 88 66 66 THR THR A . n A 1 89 PHE 89 67 67 PHE PHE A . n A 1 90 GLU 90 68 68 GLU GLU A . n A 1 91 THR 91 69 69 THR THR A . n A 1 92 LEU 92 70 70 LEU LEU A . n A 1 93 GLY 93 71 71 GLY GLY A . n A 1 94 SER 94 72 72 SER SER A . n A 1 95 LEU 95 73 73 LEU LEU A . n A 1 96 ALA 96 74 74 ALA ALA A . n A 1 97 LEU 97 75 75 LEU LEU A . n A 1 98 PHE 98 76 76 PHE PHE A . n A 1 99 VAL 99 77 77 VAL VAL A . n A 1 100 GLU 100 78 78 GLU GLU A . n A 1 101 HIS 101 79 79 HIS HIS A . n A 1 102 LYS 102 80 80 LYS LYS A . n A 1 103 LEU 103 81 81 LEU LEU A . n A 1 104 SER 104 82 82 SER SER A . n A 1 105 HIS 105 83 83 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id PNS _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 84 _pdbx_nonpoly_scheme.auth_seq_num 84 _pdbx_nonpoly_scheme.pdb_mon_id PNS _pdbx_nonpoly_scheme.auth_mon_id PNS _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-11-16 2 'Structure model' 1 1 2012-02-22 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_conn 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 3 'Structure model' '_struct_ref_seq_dif.details' 8 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 9 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 10 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1.0 ? mM '[U-13C; U-15N]' 1 MOPS-2 10 ? mM ? 1 'sodium chloride-3' 450 ? mM ? 1 ZnSO4-4 10 ? uM ? 1 DTT-5 10 ? mM ? 1 NaN3-6 0.01 ? % ? 1 benzamidine-7 1 ? mM ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 OG A SER 39 ? ? O25 A PNS 84 ? ? 1.23 2 10 OG A SER 39 ? ? O25 A PNS 84 ? ? 1.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 16 ? ? 64.22 62.00 2 1 SER A 39 ? ? -56.07 -72.92 3 2 ASN A 16 ? ? 64.61 65.62 4 2 LEU A 30 ? ? -108.26 -67.78 5 4 ASN A 16 ? ? 62.23 64.03 6 4 LEU A 30 ? ? -101.69 -70.02 7 4 ASP A 54 ? ? 64.03 64.10 8 5 LEU A 30 ? ? -110.35 -70.27 9 5 ASP A 54 ? ? 68.12 66.73 10 6 LEU A 30 ? ? -108.60 -69.74 11 7 ASN A 16 ? ? 68.28 63.52 12 7 LEU A 30 ? ? -120.97 -60.11 13 8 LEU A 30 ? ? -102.33 -67.81 14 8 ASP A 38 ? ? -125.74 -166.21 15 8 PHE A 55 ? ? -125.30 -168.70 16 9 THR A 25 ? ? -123.72 -169.47 17 9 ASP A 38 ? ? -115.68 -155.34 18 9 SER A 39 ? ? -54.26 -71.70 19 9 ASP A 54 ? ? 65.60 62.43 20 10 LEU A 30 ? ? -109.02 -66.93 21 10 ASP A 38 ? ? -132.52 -156.83 22 11 ASN A 16 ? ? 67.16 64.47 23 11 THR A 25 ? ? -118.40 -169.89 24 12 LEU A 30 ? ? -124.59 -67.13 25 13 ASN A 16 ? ? 63.26 62.72 26 13 THR A 25 ? ? -114.57 -169.54 27 13 LEU A 30 ? ? -114.27 -72.65 28 14 ASP A 38 ? ? -107.12 -164.75 29 16 ASN A 16 ? ? 60.05 63.19 30 16 LEU A 30 ? ? -105.62 -71.58 31 16 ASP A 38 ? ? -112.48 -164.53 32 17 LEU A 30 ? ? -108.18 -70.68 33 17 ASP A 38 ? ? -112.55 -168.45 34 17 SER A 39 ? ? -51.06 -70.42 35 18 ASN A 16 ? ? 71.50 38.01 36 20 ASN A 16 ? ? 62.57 62.94 37 20 SER A 39 ? ? -49.37 -70.93 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -21 ? A MET 1 2 1 Y 1 A GLY -20 ? A GLY 2 3 1 Y 1 A SER -19 ? A SER 3 4 1 Y 1 A SER -18 ? A SER 4 5 1 Y 1 A HIS -17 ? A HIS 5 6 1 Y 1 A HIS -16 ? A HIS 6 7 1 Y 1 A HIS -15 ? A HIS 7 8 1 Y 1 A HIS -14 ? A HIS 8 9 1 Y 1 A HIS -13 ? A HIS 9 10 1 Y 1 A HIS -12 ? A HIS 10 11 1 Y 1 A SER -11 ? A SER 11 12 1 Y 1 A SER -10 ? A SER 12 13 1 Y 1 A GLY -9 ? A GLY 13 14 1 Y 1 A ARG -8 ? A ARG 14 15 1 Y 1 A GLU -7 ? A GLU 15 16 1 Y 1 A ASN -6 ? A ASN 16 17 1 Y 1 A LEU -5 ? A LEU 17 18 1 Y 1 A TYR -4 ? A TYR 18 19 1 Y 1 A PHE -3 ? A PHE 19 20 1 Y 1 A GLN -2 ? A GLN 20 21 1 Y 1 A GLY -1 ? A GLY 21 22 1 Y 1 A HIS 0 ? A HIS 22 23 2 Y 1 A MET -21 ? A MET 1 24 2 Y 1 A GLY -20 ? A GLY 2 25 2 Y 1 A SER -19 ? A SER 3 26 2 Y 1 A SER -18 ? A SER 4 27 2 Y 1 A HIS -17 ? A HIS 5 28 2 Y 1 A HIS -16 ? A HIS 6 29 2 Y 1 A HIS -15 ? A HIS 7 30 2 Y 1 A HIS -14 ? A HIS 8 31 2 Y 1 A HIS -13 ? A HIS 9 32 2 Y 1 A HIS -12 ? A HIS 10 33 2 Y 1 A SER -11 ? A SER 11 34 2 Y 1 A SER -10 ? A SER 12 35 2 Y 1 A GLY -9 ? A GLY 13 36 2 Y 1 A ARG -8 ? A ARG 14 37 2 Y 1 A GLU -7 ? A GLU 15 38 2 Y 1 A ASN -6 ? A ASN 16 39 2 Y 1 A LEU -5 ? A LEU 17 40 2 Y 1 A TYR -4 ? A TYR 18 41 2 Y 1 A PHE -3 ? A PHE 19 42 2 Y 1 A GLN -2 ? A GLN 20 43 2 Y 1 A GLY -1 ? A GLY 21 44 2 Y 1 A HIS 0 ? A HIS 22 45 3 Y 1 A MET -21 ? A MET 1 46 3 Y 1 A GLY -20 ? A GLY 2 47 3 Y 1 A SER -19 ? A SER 3 48 3 Y 1 A SER -18 ? A SER 4 49 3 Y 1 A HIS -17 ? A HIS 5 50 3 Y 1 A HIS -16 ? A HIS 6 51 3 Y 1 A HIS -15 ? A HIS 7 52 3 Y 1 A HIS -14 ? A HIS 8 53 3 Y 1 A HIS -13 ? A HIS 9 54 3 Y 1 A HIS -12 ? A HIS 10 55 3 Y 1 A SER -11 ? A SER 11 56 3 Y 1 A SER -10 ? A SER 12 57 3 Y 1 A GLY -9 ? A GLY 13 58 3 Y 1 A ARG -8 ? A ARG 14 59 3 Y 1 A GLU -7 ? A GLU 15 60 3 Y 1 A ASN -6 ? A ASN 16 61 3 Y 1 A LEU -5 ? A LEU 17 62 3 Y 1 A TYR -4 ? A TYR 18 63 3 Y 1 A PHE -3 ? A PHE 19 64 3 Y 1 A GLN -2 ? A GLN 20 65 3 Y 1 A GLY -1 ? A GLY 21 66 3 Y 1 A HIS 0 ? A HIS 22 67 4 Y 1 A MET -21 ? A MET 1 68 4 Y 1 A GLY -20 ? A GLY 2 69 4 Y 1 A SER -19 ? A SER 3 70 4 Y 1 A SER -18 ? A SER 4 71 4 Y 1 A HIS -17 ? A HIS 5 72 4 Y 1 A HIS -16 ? A HIS 6 73 4 Y 1 A HIS -15 ? A HIS 7 74 4 Y 1 A HIS -14 ? A HIS 8 75 4 Y 1 A HIS -13 ? A HIS 9 76 4 Y 1 A HIS -12 ? A HIS 10 77 4 Y 1 A SER -11 ? A SER 11 78 4 Y 1 A SER -10 ? A SER 12 79 4 Y 1 A GLY -9 ? A GLY 13 80 4 Y 1 A ARG -8 ? A ARG 14 81 4 Y 1 A GLU -7 ? A GLU 15 82 4 Y 1 A ASN -6 ? A ASN 16 83 4 Y 1 A LEU -5 ? A LEU 17 84 4 Y 1 A TYR -4 ? A TYR 18 85 4 Y 1 A PHE -3 ? A PHE 19 86 4 Y 1 A GLN -2 ? A GLN 20 87 4 Y 1 A GLY -1 ? A GLY 21 88 4 Y 1 A HIS 0 ? A HIS 22 89 5 Y 1 A MET -21 ? A MET 1 90 5 Y 1 A GLY -20 ? A GLY 2 91 5 Y 1 A SER -19 ? A SER 3 92 5 Y 1 A SER -18 ? A SER 4 93 5 Y 1 A HIS -17 ? A HIS 5 94 5 Y 1 A HIS -16 ? A HIS 6 95 5 Y 1 A HIS -15 ? A HIS 7 96 5 Y 1 A HIS -14 ? A HIS 8 97 5 Y 1 A HIS -13 ? A HIS 9 98 5 Y 1 A HIS -12 ? A HIS 10 99 5 Y 1 A SER -11 ? A SER 11 100 5 Y 1 A SER -10 ? A SER 12 101 5 Y 1 A GLY -9 ? A GLY 13 102 5 Y 1 A ARG -8 ? A ARG 14 103 5 Y 1 A GLU -7 ? A GLU 15 104 5 Y 1 A ASN -6 ? A ASN 16 105 5 Y 1 A LEU -5 ? A LEU 17 106 5 Y 1 A TYR -4 ? A TYR 18 107 5 Y 1 A PHE -3 ? A PHE 19 108 5 Y 1 A GLN -2 ? A GLN 20 109 5 Y 1 A GLY -1 ? A GLY 21 110 5 Y 1 A HIS 0 ? A HIS 22 111 6 Y 1 A MET -21 ? A MET 1 112 6 Y 1 A GLY -20 ? A GLY 2 113 6 Y 1 A SER -19 ? A SER 3 114 6 Y 1 A SER -18 ? A SER 4 115 6 Y 1 A HIS -17 ? A HIS 5 116 6 Y 1 A HIS -16 ? A HIS 6 117 6 Y 1 A HIS -15 ? A HIS 7 118 6 Y 1 A HIS -14 ? A HIS 8 119 6 Y 1 A HIS -13 ? A HIS 9 120 6 Y 1 A HIS -12 ? A HIS 10 121 6 Y 1 A SER -11 ? A SER 11 122 6 Y 1 A SER -10 ? A SER 12 123 6 Y 1 A GLY -9 ? A GLY 13 124 6 Y 1 A ARG -8 ? A ARG 14 125 6 Y 1 A GLU -7 ? A GLU 15 126 6 Y 1 A ASN -6 ? A ASN 16 127 6 Y 1 A LEU -5 ? A LEU 17 128 6 Y 1 A TYR -4 ? A TYR 18 129 6 Y 1 A PHE -3 ? A PHE 19 130 6 Y 1 A GLN -2 ? A GLN 20 131 6 Y 1 A GLY -1 ? A GLY 21 132 6 Y 1 A HIS 0 ? A HIS 22 133 7 Y 1 A MET -21 ? A MET 1 134 7 Y 1 A GLY -20 ? A GLY 2 135 7 Y 1 A SER -19 ? A SER 3 136 7 Y 1 A SER -18 ? A SER 4 137 7 Y 1 A HIS -17 ? A HIS 5 138 7 Y 1 A HIS -16 ? A HIS 6 139 7 Y 1 A HIS -15 ? A HIS 7 140 7 Y 1 A HIS -14 ? A HIS 8 141 7 Y 1 A HIS -13 ? A HIS 9 142 7 Y 1 A HIS -12 ? A HIS 10 143 7 Y 1 A SER -11 ? A SER 11 144 7 Y 1 A SER -10 ? A SER 12 145 7 Y 1 A GLY -9 ? A GLY 13 146 7 Y 1 A ARG -8 ? A ARG 14 147 7 Y 1 A GLU -7 ? A GLU 15 148 7 Y 1 A ASN -6 ? A ASN 16 149 7 Y 1 A LEU -5 ? A LEU 17 150 7 Y 1 A TYR -4 ? A TYR 18 151 7 Y 1 A PHE -3 ? A PHE 19 152 7 Y 1 A GLN -2 ? A GLN 20 153 7 Y 1 A GLY -1 ? A GLY 21 154 7 Y 1 A HIS 0 ? A HIS 22 155 8 Y 1 A MET -21 ? A MET 1 156 8 Y 1 A GLY -20 ? A GLY 2 157 8 Y 1 A SER -19 ? A SER 3 158 8 Y 1 A SER -18 ? A SER 4 159 8 Y 1 A HIS -17 ? A HIS 5 160 8 Y 1 A HIS -16 ? A HIS 6 161 8 Y 1 A HIS -15 ? A HIS 7 162 8 Y 1 A HIS -14 ? A HIS 8 163 8 Y 1 A HIS -13 ? A HIS 9 164 8 Y 1 A HIS -12 ? A HIS 10 165 8 Y 1 A SER -11 ? A SER 11 166 8 Y 1 A SER -10 ? A SER 12 167 8 Y 1 A GLY -9 ? A GLY 13 168 8 Y 1 A ARG -8 ? A ARG 14 169 8 Y 1 A GLU -7 ? A GLU 15 170 8 Y 1 A ASN -6 ? A ASN 16 171 8 Y 1 A LEU -5 ? A LEU 17 172 8 Y 1 A TYR -4 ? A TYR 18 173 8 Y 1 A PHE -3 ? A PHE 19 174 8 Y 1 A GLN -2 ? A GLN 20 175 8 Y 1 A GLY -1 ? A GLY 21 176 8 Y 1 A HIS 0 ? A HIS 22 177 9 Y 1 A MET -21 ? A MET 1 178 9 Y 1 A GLY -20 ? A GLY 2 179 9 Y 1 A SER -19 ? A SER 3 180 9 Y 1 A SER -18 ? A SER 4 181 9 Y 1 A HIS -17 ? A HIS 5 182 9 Y 1 A HIS -16 ? A HIS 6 183 9 Y 1 A HIS -15 ? A HIS 7 184 9 Y 1 A HIS -14 ? A HIS 8 185 9 Y 1 A HIS -13 ? A HIS 9 186 9 Y 1 A HIS -12 ? A HIS 10 187 9 Y 1 A SER -11 ? A SER 11 188 9 Y 1 A SER -10 ? A SER 12 189 9 Y 1 A GLY -9 ? A GLY 13 190 9 Y 1 A ARG -8 ? A ARG 14 191 9 Y 1 A GLU -7 ? A GLU 15 192 9 Y 1 A ASN -6 ? A ASN 16 193 9 Y 1 A LEU -5 ? A LEU 17 194 9 Y 1 A TYR -4 ? A TYR 18 195 9 Y 1 A PHE -3 ? A PHE 19 196 9 Y 1 A GLN -2 ? A GLN 20 197 9 Y 1 A GLY -1 ? A GLY 21 198 9 Y 1 A HIS 0 ? A HIS 22 199 10 Y 1 A MET -21 ? A MET 1 200 10 Y 1 A GLY -20 ? A GLY 2 201 10 Y 1 A SER -19 ? A SER 3 202 10 Y 1 A SER -18 ? A SER 4 203 10 Y 1 A HIS -17 ? A HIS 5 204 10 Y 1 A HIS -16 ? A HIS 6 205 10 Y 1 A HIS -15 ? A HIS 7 206 10 Y 1 A HIS -14 ? A HIS 8 207 10 Y 1 A HIS -13 ? A HIS 9 208 10 Y 1 A HIS -12 ? A HIS 10 209 10 Y 1 A SER -11 ? A SER 11 210 10 Y 1 A SER -10 ? A SER 12 211 10 Y 1 A GLY -9 ? A GLY 13 212 10 Y 1 A ARG -8 ? A ARG 14 213 10 Y 1 A GLU -7 ? A GLU 15 214 10 Y 1 A ASN -6 ? A ASN 16 215 10 Y 1 A LEU -5 ? A LEU 17 216 10 Y 1 A TYR -4 ? A TYR 18 217 10 Y 1 A PHE -3 ? A PHE 19 218 10 Y 1 A GLN -2 ? A GLN 20 219 10 Y 1 A GLY -1 ? A GLY 21 220 10 Y 1 A HIS 0 ? A HIS 22 221 11 Y 1 A MET -21 ? A MET 1 222 11 Y 1 A GLY -20 ? A GLY 2 223 11 Y 1 A SER -19 ? A SER 3 224 11 Y 1 A SER -18 ? A SER 4 225 11 Y 1 A HIS -17 ? A HIS 5 226 11 Y 1 A HIS -16 ? A HIS 6 227 11 Y 1 A HIS -15 ? A HIS 7 228 11 Y 1 A HIS -14 ? A HIS 8 229 11 Y 1 A HIS -13 ? A HIS 9 230 11 Y 1 A HIS -12 ? A HIS 10 231 11 Y 1 A SER -11 ? A SER 11 232 11 Y 1 A SER -10 ? A SER 12 233 11 Y 1 A GLY -9 ? A GLY 13 234 11 Y 1 A ARG -8 ? A ARG 14 235 11 Y 1 A GLU -7 ? A GLU 15 236 11 Y 1 A ASN -6 ? A ASN 16 237 11 Y 1 A LEU -5 ? A LEU 17 238 11 Y 1 A TYR -4 ? A TYR 18 239 11 Y 1 A PHE -3 ? A PHE 19 240 11 Y 1 A GLN -2 ? A GLN 20 241 11 Y 1 A GLY -1 ? A GLY 21 242 11 Y 1 A HIS 0 ? A HIS 22 243 12 Y 1 A MET -21 ? A MET 1 244 12 Y 1 A GLY -20 ? A GLY 2 245 12 Y 1 A SER -19 ? A SER 3 246 12 Y 1 A SER -18 ? A SER 4 247 12 Y 1 A HIS -17 ? A HIS 5 248 12 Y 1 A HIS -16 ? A HIS 6 249 12 Y 1 A HIS -15 ? A HIS 7 250 12 Y 1 A HIS -14 ? A HIS 8 251 12 Y 1 A HIS -13 ? A HIS 9 252 12 Y 1 A HIS -12 ? A HIS 10 253 12 Y 1 A SER -11 ? A SER 11 254 12 Y 1 A SER -10 ? A SER 12 255 12 Y 1 A GLY -9 ? A GLY 13 256 12 Y 1 A ARG -8 ? A ARG 14 257 12 Y 1 A GLU -7 ? A GLU 15 258 12 Y 1 A ASN -6 ? A ASN 16 259 12 Y 1 A LEU -5 ? A LEU 17 260 12 Y 1 A TYR -4 ? A TYR 18 261 12 Y 1 A PHE -3 ? A PHE 19 262 12 Y 1 A GLN -2 ? A GLN 20 263 12 Y 1 A GLY -1 ? A GLY 21 264 12 Y 1 A HIS 0 ? A HIS 22 265 13 Y 1 A MET -21 ? A MET 1 266 13 Y 1 A GLY -20 ? A GLY 2 267 13 Y 1 A SER -19 ? A SER 3 268 13 Y 1 A SER -18 ? A SER 4 269 13 Y 1 A HIS -17 ? A HIS 5 270 13 Y 1 A HIS -16 ? A HIS 6 271 13 Y 1 A HIS -15 ? A HIS 7 272 13 Y 1 A HIS -14 ? A HIS 8 273 13 Y 1 A HIS -13 ? A HIS 9 274 13 Y 1 A HIS -12 ? A HIS 10 275 13 Y 1 A SER -11 ? A SER 11 276 13 Y 1 A SER -10 ? A SER 12 277 13 Y 1 A GLY -9 ? A GLY 13 278 13 Y 1 A ARG -8 ? A ARG 14 279 13 Y 1 A GLU -7 ? A GLU 15 280 13 Y 1 A ASN -6 ? A ASN 16 281 13 Y 1 A LEU -5 ? A LEU 17 282 13 Y 1 A TYR -4 ? A TYR 18 283 13 Y 1 A PHE -3 ? A PHE 19 284 13 Y 1 A GLN -2 ? A GLN 20 285 13 Y 1 A GLY -1 ? A GLY 21 286 13 Y 1 A HIS 0 ? A HIS 22 287 14 Y 1 A MET -21 ? A MET 1 288 14 Y 1 A GLY -20 ? A GLY 2 289 14 Y 1 A SER -19 ? A SER 3 290 14 Y 1 A SER -18 ? A SER 4 291 14 Y 1 A HIS -17 ? A HIS 5 292 14 Y 1 A HIS -16 ? A HIS 6 293 14 Y 1 A HIS -15 ? A HIS 7 294 14 Y 1 A HIS -14 ? A HIS 8 295 14 Y 1 A HIS -13 ? A HIS 9 296 14 Y 1 A HIS -12 ? A HIS 10 297 14 Y 1 A SER -11 ? A SER 11 298 14 Y 1 A SER -10 ? A SER 12 299 14 Y 1 A GLY -9 ? A GLY 13 300 14 Y 1 A ARG -8 ? A ARG 14 301 14 Y 1 A GLU -7 ? A GLU 15 302 14 Y 1 A ASN -6 ? A ASN 16 303 14 Y 1 A LEU -5 ? A LEU 17 304 14 Y 1 A TYR -4 ? A TYR 18 305 14 Y 1 A PHE -3 ? A PHE 19 306 14 Y 1 A GLN -2 ? A GLN 20 307 14 Y 1 A GLY -1 ? A GLY 21 308 14 Y 1 A HIS 0 ? A HIS 22 309 15 Y 1 A MET -21 ? A MET 1 310 15 Y 1 A GLY -20 ? A GLY 2 311 15 Y 1 A SER -19 ? A SER 3 312 15 Y 1 A SER -18 ? A SER 4 313 15 Y 1 A HIS -17 ? A HIS 5 314 15 Y 1 A HIS -16 ? A HIS 6 315 15 Y 1 A HIS -15 ? A HIS 7 316 15 Y 1 A HIS -14 ? A HIS 8 317 15 Y 1 A HIS -13 ? A HIS 9 318 15 Y 1 A HIS -12 ? A HIS 10 319 15 Y 1 A SER -11 ? A SER 11 320 15 Y 1 A SER -10 ? A SER 12 321 15 Y 1 A GLY -9 ? A GLY 13 322 15 Y 1 A ARG -8 ? A ARG 14 323 15 Y 1 A GLU -7 ? A GLU 15 324 15 Y 1 A ASN -6 ? A ASN 16 325 15 Y 1 A LEU -5 ? A LEU 17 326 15 Y 1 A TYR -4 ? A TYR 18 327 15 Y 1 A PHE -3 ? A PHE 19 328 15 Y 1 A GLN -2 ? A GLN 20 329 15 Y 1 A GLY -1 ? A GLY 21 330 15 Y 1 A HIS 0 ? A HIS 22 331 16 Y 1 A MET -21 ? A MET 1 332 16 Y 1 A GLY -20 ? A GLY 2 333 16 Y 1 A SER -19 ? A SER 3 334 16 Y 1 A SER -18 ? A SER 4 335 16 Y 1 A HIS -17 ? A HIS 5 336 16 Y 1 A HIS -16 ? A HIS 6 337 16 Y 1 A HIS -15 ? A HIS 7 338 16 Y 1 A HIS -14 ? A HIS 8 339 16 Y 1 A HIS -13 ? A HIS 9 340 16 Y 1 A HIS -12 ? A HIS 10 341 16 Y 1 A SER -11 ? A SER 11 342 16 Y 1 A SER -10 ? A SER 12 343 16 Y 1 A GLY -9 ? A GLY 13 344 16 Y 1 A ARG -8 ? A ARG 14 345 16 Y 1 A GLU -7 ? A GLU 15 346 16 Y 1 A ASN -6 ? A ASN 16 347 16 Y 1 A LEU -5 ? A LEU 17 348 16 Y 1 A TYR -4 ? A TYR 18 349 16 Y 1 A PHE -3 ? A PHE 19 350 16 Y 1 A GLN -2 ? A GLN 20 351 16 Y 1 A GLY -1 ? A GLY 21 352 16 Y 1 A HIS 0 ? A HIS 22 353 17 Y 1 A MET -21 ? A MET 1 354 17 Y 1 A GLY -20 ? A GLY 2 355 17 Y 1 A SER -19 ? A SER 3 356 17 Y 1 A SER -18 ? A SER 4 357 17 Y 1 A HIS -17 ? A HIS 5 358 17 Y 1 A HIS -16 ? A HIS 6 359 17 Y 1 A HIS -15 ? A HIS 7 360 17 Y 1 A HIS -14 ? A HIS 8 361 17 Y 1 A HIS -13 ? A HIS 9 362 17 Y 1 A HIS -12 ? A HIS 10 363 17 Y 1 A SER -11 ? A SER 11 364 17 Y 1 A SER -10 ? A SER 12 365 17 Y 1 A GLY -9 ? A GLY 13 366 17 Y 1 A ARG -8 ? A ARG 14 367 17 Y 1 A GLU -7 ? A GLU 15 368 17 Y 1 A ASN -6 ? A ASN 16 369 17 Y 1 A LEU -5 ? A LEU 17 370 17 Y 1 A TYR -4 ? A TYR 18 371 17 Y 1 A PHE -3 ? A PHE 19 372 17 Y 1 A GLN -2 ? A GLN 20 373 17 Y 1 A GLY -1 ? A GLY 21 374 17 Y 1 A HIS 0 ? A HIS 22 375 18 Y 1 A MET -21 ? A MET 1 376 18 Y 1 A GLY -20 ? A GLY 2 377 18 Y 1 A SER -19 ? A SER 3 378 18 Y 1 A SER -18 ? A SER 4 379 18 Y 1 A HIS -17 ? A HIS 5 380 18 Y 1 A HIS -16 ? A HIS 6 381 18 Y 1 A HIS -15 ? A HIS 7 382 18 Y 1 A HIS -14 ? A HIS 8 383 18 Y 1 A HIS -13 ? A HIS 9 384 18 Y 1 A HIS -12 ? A HIS 10 385 18 Y 1 A SER -11 ? A SER 11 386 18 Y 1 A SER -10 ? A SER 12 387 18 Y 1 A GLY -9 ? A GLY 13 388 18 Y 1 A ARG -8 ? A ARG 14 389 18 Y 1 A GLU -7 ? A GLU 15 390 18 Y 1 A ASN -6 ? A ASN 16 391 18 Y 1 A LEU -5 ? A LEU 17 392 18 Y 1 A TYR -4 ? A TYR 18 393 18 Y 1 A PHE -3 ? A PHE 19 394 18 Y 1 A GLN -2 ? A GLN 20 395 18 Y 1 A GLY -1 ? A GLY 21 396 18 Y 1 A HIS 0 ? A HIS 22 397 19 Y 1 A MET -21 ? A MET 1 398 19 Y 1 A GLY -20 ? A GLY 2 399 19 Y 1 A SER -19 ? A SER 3 400 19 Y 1 A SER -18 ? A SER 4 401 19 Y 1 A HIS -17 ? A HIS 5 402 19 Y 1 A HIS -16 ? A HIS 6 403 19 Y 1 A HIS -15 ? A HIS 7 404 19 Y 1 A HIS -14 ? A HIS 8 405 19 Y 1 A HIS -13 ? A HIS 9 406 19 Y 1 A HIS -12 ? A HIS 10 407 19 Y 1 A SER -11 ? A SER 11 408 19 Y 1 A SER -10 ? A SER 12 409 19 Y 1 A GLY -9 ? A GLY 13 410 19 Y 1 A ARG -8 ? A ARG 14 411 19 Y 1 A GLU -7 ? A GLU 15 412 19 Y 1 A ASN -6 ? A ASN 16 413 19 Y 1 A LEU -5 ? A LEU 17 414 19 Y 1 A TYR -4 ? A TYR 18 415 19 Y 1 A PHE -3 ? A PHE 19 416 19 Y 1 A GLN -2 ? A GLN 20 417 19 Y 1 A GLY -1 ? A GLY 21 418 19 Y 1 A HIS 0 ? A HIS 22 419 20 Y 1 A MET -21 ? A MET 1 420 20 Y 1 A GLY -20 ? A GLY 2 421 20 Y 1 A SER -19 ? A SER 3 422 20 Y 1 A SER -18 ? A SER 4 423 20 Y 1 A HIS -17 ? A HIS 5 424 20 Y 1 A HIS -16 ? A HIS 6 425 20 Y 1 A HIS -15 ? A HIS 7 426 20 Y 1 A HIS -14 ? A HIS 8 427 20 Y 1 A HIS -13 ? A HIS 9 428 20 Y 1 A HIS -12 ? A HIS 10 429 20 Y 1 A SER -11 ? A SER 11 430 20 Y 1 A SER -10 ? A SER 12 431 20 Y 1 A GLY -9 ? A GLY 13 432 20 Y 1 A ARG -8 ? A ARG 14 433 20 Y 1 A GLU -7 ? A GLU 15 434 20 Y 1 A ASN -6 ? A ASN 16 435 20 Y 1 A LEU -5 ? A LEU 17 436 20 Y 1 A TYR -4 ? A TYR 18 437 20 Y 1 A PHE -3 ? A PHE 19 438 20 Y 1 A GLN -2 ? A GLN 20 439 20 Y 1 A GLY -1 ? A GLY 21 440 20 Y 1 A HIS 0 ? A HIS 22 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name "4'-PHOSPHOPANTETHEINE" _pdbx_entity_nonpoly.comp_id PNS #