data_2LKZ # _entry.id 2LKZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LKZ pdb_00002lkz 10.2210/pdb2lkz/pdb RCSB RCSB102509 ? ? WWPDB D_1000102509 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-08-08 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' struct_ref_seq_dif 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LKZ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2011-10-23 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 18017 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Song, Z.' 1 'Wu, P.' 2 'Zhang, J.' 3 'Wu, J.' 4 'Shi, Y.' 5 # _citation.id primary _citation.title 'Solution structure of the second RRM domain of RBM5 and its unusual binding characters for different RNA targets' _citation.journal_abbrev Biochemistry _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year 2012 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22839758 _citation.pdbx_database_id_DOI 10.1021/bi300539t # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Song, Z.' 1 ? primary 'Wu, P.' 2 ? primary 'Ji, P.' 3 ? primary 'Zhang, J.' 4 ? primary 'Gong, Q.' 5 ? primary 'Wu, J.' 6 ? primary 'Shi, Y.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'RNA-binding protein 5' _entity.formula_weight 10518.144 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RRM 2 domain, UNP residues 231-316' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein G15, Putative tumor suppressor LUCA15, RNA-binding motif protein 5, Renal carcinoma antigen NY-REN-9' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHMDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPPL KIDGKTIGVDFAKSA ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHMDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPPL KIDGKTIGVDFAKSA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 ASP n 1 11 THR n 1 12 ILE n 1 13 ILE n 1 14 LEU n 1 15 ARG n 1 16 ASN n 1 17 ILE n 1 18 ALA n 1 19 PRO n 1 20 HIS n 1 21 THR n 1 22 VAL n 1 23 VAL n 1 24 ASP n 1 25 SER n 1 26 ILE n 1 27 MET n 1 28 THR n 1 29 ALA n 1 30 LEU n 1 31 SER n 1 32 PRO n 1 33 TYR n 1 34 ALA n 1 35 SER n 1 36 LEU n 1 37 ALA n 1 38 VAL n 1 39 ASN n 1 40 ASN n 1 41 ILE n 1 42 ARG n 1 43 LEU n 1 44 ILE n 1 45 LYS n 1 46 ASP n 1 47 LYS n 1 48 GLN n 1 49 THR n 1 50 GLN n 1 51 GLN n 1 52 ASN n 1 53 ARG n 1 54 GLY n 1 55 PHE n 1 56 ALA n 1 57 PHE n 1 58 VAL n 1 59 GLN n 1 60 LEU n 1 61 SER n 1 62 SER n 1 63 ALA n 1 64 MET n 1 65 ASP n 1 66 ALA n 1 67 SER n 1 68 GLN n 1 69 LEU n 1 70 LEU n 1 71 GLN n 1 72 ILE n 1 73 LEU n 1 74 GLN n 1 75 SER n 1 76 LEU n 1 77 HIS n 1 78 PRO n 1 79 PRO n 1 80 LEU n 1 81 LYS n 1 82 ILE n 1 83 ASP n 1 84 GLY n 1 85 LYS n 1 86 THR n 1 87 ILE n 1 88 GLY n 1 89 VAL n 1 90 ASP n 1 91 PHE n 1 92 ALA n 1 93 LYS n 1 94 SER n 1 95 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RBM5, H37, LUCA15' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector 'pET28a modified' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ALA 95 95 95 ALA ALA A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LKZ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LKZ _struct.title 'Solution structure of the second RRM domain of RBM5' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LKZ _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'RRM, RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RBM5_HUMAN _struct_ref.pdbx_db_accession P52756 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPPLKIDGKTIGV DFAKSA ; _struct_ref.pdbx_align_begin 231 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LKZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 10 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 95 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P52756 _struct_ref_seq.db_align_beg 231 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 316 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 10 _struct_ref_seq.pdbx_auth_seq_align_end 95 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LKZ MET A 1 ? UNP P52756 ? ? 'expression tag' 1 1 1 2LKZ GLY A 2 ? UNP P52756 ? ? 'expression tag' 2 2 1 2LKZ HIS A 3 ? UNP P52756 ? ? 'expression tag' 3 3 1 2LKZ HIS A 4 ? UNP P52756 ? ? 'expression tag' 4 4 1 2LKZ HIS A 5 ? UNP P52756 ? ? 'expression tag' 5 5 1 2LKZ HIS A 6 ? UNP P52756 ? ? 'expression tag' 6 6 1 2LKZ HIS A 7 ? UNP P52756 ? ? 'expression tag' 7 7 1 2LKZ HIS A 8 ? UNP P52756 ? ? 'expression tag' 8 8 1 2LKZ MET A 9 ? UNP P52756 ? ? 'expression tag' 9 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 22 ? LEU A 30 ? VAL A 22 LEU A 30 1 ? 9 HELX_P HELX_P2 2 ALA A 37 ? ASN A 39 ? ALA A 37 ASN A 39 5 ? 3 HELX_P HELX_P3 3 ALA A 63 ? SER A 75 ? ALA A 63 SER A 75 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 41 ? ARG A 42 ? ILE A 41 ARG A 42 A 2 PHE A 55 ? GLN A 59 ? PHE A 55 GLN A 59 A 3 THR A 11 ? ARG A 15 ? THR A 11 ARG A 15 A 4 LYS A 85 ? PHE A 91 ? LYS A 85 PHE A 91 A 5 LEU A 80 ? ILE A 82 ? LEU A 80 ILE A 82 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 42 ? N ARG A 42 O PHE A 57 ? O PHE A 57 A 2 3 O VAL A 58 ? O VAL A 58 N ILE A 12 ? N ILE A 12 A 3 4 N ILE A 13 ? N ILE A 13 O ASP A 90 ? O ASP A 90 A 4 5 O ILE A 87 ? O ILE A 87 N LEU A 80 ? N LEU A 80 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 8 _pdbx_validate_close_contact.auth_atom_id_1 H1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 MET _pdbx_validate_close_contact.auth_seq_id_1 1 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLY _pdbx_validate_close_contact.auth_seq_id_2 2 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.31 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 8 ? ? -156.69 21.05 2 1 MET A 9 ? ? 58.69 147.08 3 1 ASP A 10 ? ? -174.01 33.09 4 1 ALA A 34 ? ? 175.75 -179.98 5 1 GLN A 50 ? ? 45.93 28.30 6 1 ASN A 52 ? ? -34.88 143.07 7 1 PRO A 79 ? ? -48.38 -176.71 8 1 ASP A 83 ? ? -34.51 103.88 9 1 LYS A 85 ? ? -177.56 -178.09 10 2 HIS A 3 ? ? 64.65 144.54 11 2 HIS A 4 ? ? -163.45 71.73 12 2 HIS A 6 ? ? -142.28 26.18 13 2 ASP A 10 ? ? -174.80 31.06 14 2 ASN A 16 ? ? 62.15 60.53 15 2 ALA A 34 ? ? 176.84 -176.34 16 2 GLN A 50 ? ? 42.05 29.40 17 2 ASN A 52 ? ? -37.24 142.02 18 2 ARG A 53 ? ? -89.41 32.88 19 2 PRO A 79 ? ? -48.37 -176.96 20 2 ASP A 83 ? ? -33.01 104.41 21 2 LYS A 85 ? ? -172.19 -179.74 22 2 LYS A 93 ? ? -101.35 -165.28 23 3 HIS A 3 ? ? -68.53 -79.79 24 3 HIS A 4 ? ? 45.86 90.13 25 3 HIS A 5 ? ? -60.98 75.28 26 3 ASP A 10 ? ? -175.42 37.68 27 3 ALA A 34 ? ? 173.07 -179.50 28 3 ILE A 44 ? ? -59.90 107.05 29 3 ASN A 52 ? ? -36.81 144.58 30 3 ARG A 53 ? ? -91.22 32.51 31 3 ASP A 83 ? ? -34.38 103.88 32 3 LYS A 85 ? ? 177.39 -175.82 33 4 HIS A 4 ? ? -144.19 -94.25 34 4 HIS A 7 ? ? -84.68 40.31 35 4 ASP A 10 ? ? -158.98 27.28 36 4 ASN A 16 ? ? 75.84 55.93 37 4 ALA A 34 ? ? -177.69 -171.36 38 4 ILE A 44 ? ? -60.15 97.74 39 4 ASN A 52 ? ? -38.28 129.77 40 4 PRO A 79 ? ? -47.95 -178.10 41 4 ASP A 83 ? ? -31.15 104.41 42 4 SER A 94 ? ? -105.57 45.74 43 5 HIS A 4 ? ? 59.01 147.62 44 5 HIS A 7 ? ? -158.12 -0.47 45 5 HIS A 8 ? ? -96.97 -124.93 46 5 ASP A 10 ? ? -175.08 26.83 47 5 ASN A 16 ? ? 80.04 52.93 48 5 ALA A 34 ? ? -173.47 -171.79 49 5 ILE A 44 ? ? -60.13 96.15 50 5 ASN A 52 ? ? -38.17 143.86 51 5 PRO A 79 ? ? -47.88 -178.00 52 5 ASP A 83 ? ? -34.26 103.97 53 5 LYS A 85 ? ? 178.86 -175.88 54 6 HIS A 6 ? ? 56.91 109.42 55 6 HIS A 8 ? ? 47.39 98.37 56 6 ASP A 10 ? ? -169.55 43.58 57 6 ASN A 16 ? ? 73.86 53.88 58 6 ALA A 34 ? ? 174.40 -177.95 59 6 ASN A 52 ? ? -33.49 139.04 60 6 PRO A 79 ? ? -47.91 -177.17 61 6 ASP A 83 ? ? -33.36 104.08 62 6 ALA A 92 ? ? -102.79 75.86 63 6 SER A 94 ? ? -56.03 95.25 64 7 HIS A 6 ? ? -154.18 59.63 65 7 ASP A 10 ? ? -168.54 41.76 66 7 ALA A 34 ? ? 173.67 179.90 67 7 ASN A 52 ? ? -36.18 140.17 68 7 PRO A 79 ? ? -48.30 -177.04 69 7 ASP A 83 ? ? -31.08 104.22 70 7 SER A 94 ? ? -76.84 39.89 71 8 HIS A 3 ? ? -140.49 -50.37 72 8 HIS A 7 ? ? 55.27 100.84 73 8 ASP A 10 ? ? -167.28 23.33 74 8 ASN A 16 ? ? 72.21 60.58 75 8 ALA A 34 ? ? 176.93 -177.61 76 8 LYS A 47 ? ? -69.09 8.99 77 8 ASN A 52 ? ? -35.98 136.03 78 8 PRO A 79 ? ? -48.17 -177.92 79 8 ASP A 83 ? ? -32.72 104.17 80 8 LYS A 93 ? ? 49.72 93.67 81 8 SER A 94 ? ? -59.40 79.79 82 9 HIS A 3 ? ? -68.10 -166.34 83 9 HIS A 4 ? ? -123.31 -100.67 84 9 HIS A 5 ? ? 47.50 -172.61 85 9 HIS A 7 ? ? -164.78 43.67 86 9 HIS A 8 ? ? 54.21 176.25 87 9 MET A 9 ? ? 58.74 147.06 88 9 ASP A 10 ? ? -173.79 27.05 89 9 ASN A 16 ? ? 71.00 56.72 90 9 PRO A 19 ? ? -44.85 -10.75 91 9 ALA A 34 ? ? -173.90 -170.57 92 9 ASN A 52 ? ? -37.69 131.89 93 9 PRO A 79 ? ? -47.81 -177.82 94 9 ASP A 83 ? ? -31.70 103.91 95 9 LYS A 85 ? ? -174.08 -177.12 96 9 LYS A 93 ? ? 60.35 127.88 97 10 HIS A 3 ? ? 44.91 -91.33 98 10 HIS A 5 ? ? -59.15 81.64 99 10 HIS A 6 ? ? -48.13 169.67 100 10 ASP A 10 ? ? -168.81 30.07 101 10 ALA A 34 ? ? 179.14 -178.10 102 10 GLN A 50 ? ? 46.47 28.58 103 10 ARG A 53 ? ? -86.58 36.06 104 10 ASP A 83 ? ? -33.06 103.85 105 10 LYS A 85 ? ? -178.28 -177.73 106 10 SER A 94 ? ? 53.58 82.54 107 11 HIS A 4 ? ? 52.27 -126.56 108 11 HIS A 5 ? ? -178.15 -42.67 109 11 HIS A 6 ? ? -78.85 46.76 110 11 ASP A 10 ? ? -165.49 30.36 111 11 ASN A 16 ? ? 70.51 59.49 112 11 ALA A 34 ? ? -177.49 -170.79 113 11 ASN A 52 ? ? -39.64 134.09 114 11 ASP A 83 ? ? -35.33 102.86 115 11 LYS A 85 ? ? 179.06 -174.77 116 11 SER A 94 ? ? -179.72 94.96 117 12 HIS A 6 ? ? 41.76 -163.59 118 12 HIS A 8 ? ? -136.96 -77.54 119 12 ASP A 10 ? ? -175.76 36.82 120 12 ASN A 16 ? ? 77.33 52.21 121 12 ALA A 34 ? ? -177.56 -169.28 122 12 ASN A 52 ? ? -38.76 140.12 123 12 ARG A 53 ? ? -90.74 34.28 124 12 PRO A 79 ? ? -48.75 -176.03 125 12 ASP A 83 ? ? -33.66 103.95 126 12 LYS A 85 ? ? 175.34 -175.90 127 12 ALA A 92 ? ? -57.52 -179.60 128 12 SER A 94 ? ? -107.46 59.85 129 13 ASP A 10 ? ? -169.28 23.84 130 13 ALA A 34 ? ? 173.94 -179.72 131 13 LYS A 47 ? ? -63.24 2.96 132 13 ASN A 52 ? ? -36.05 140.60 133 13 ARG A 53 ? ? -98.31 45.80 134 13 PRO A 79 ? ? -48.11 -177.04 135 13 ASP A 83 ? ? -31.39 104.03 136 14 HIS A 3 ? ? -145.00 -127.93 137 14 HIS A 4 ? ? 54.38 107.64 138 14 HIS A 7 ? ? -67.47 -92.21 139 14 HIS A 8 ? ? 53.02 96.51 140 14 MET A 9 ? ? 55.66 111.60 141 14 ASP A 10 ? ? -158.09 26.82 142 14 ASN A 16 ? ? 73.09 54.05 143 14 ALA A 34 ? ? 176.68 -179.25 144 14 ASN A 52 ? ? -36.91 130.59 145 14 PRO A 79 ? ? -49.07 -176.14 146 14 ASP A 83 ? ? -33.14 104.05 147 14 LYS A 85 ? ? -173.91 -178.39 148 14 SER A 94 ? ? -143.65 27.99 149 15 HIS A 4 ? ? -172.12 45.94 150 15 HIS A 6 ? ? -151.49 -44.32 151 15 HIS A 7 ? ? -171.67 73.82 152 15 ASP A 10 ? ? -164.30 26.94 153 15 ASN A 16 ? ? 60.84 68.90 154 15 ALA A 34 ? ? 174.19 -179.09 155 15 ASN A 52 ? ? -36.73 142.16 156 15 ARG A 53 ? ? -94.49 33.80 157 15 PRO A 79 ? ? -47.83 -178.50 158 15 ASP A 83 ? ? -30.31 104.34 159 15 SER A 94 ? ? -144.07 33.02 160 16 HIS A 6 ? ? -98.91 31.15 161 16 MET A 9 ? ? 58.83 146.22 162 16 ASP A 10 ? ? -172.68 32.44 163 16 ASN A 16 ? ? 79.18 53.36 164 16 ALA A 34 ? ? -178.22 -170.96 165 16 ILE A 44 ? ? -60.15 96.36 166 16 GLN A 50 ? ? 43.90 25.88 167 16 ASN A 52 ? ? -35.82 141.39 168 16 PRO A 79 ? ? -48.26 -177.24 169 16 ASP A 83 ? ? -33.86 104.13 170 16 LYS A 85 ? ? 178.93 -176.31 171 16 ALA A 92 ? ? -52.78 89.02 172 16 SER A 94 ? ? -178.57 89.99 173 17 HIS A 4 ? ? -147.23 -80.49 174 17 MET A 9 ? ? 55.44 112.50 175 17 ASP A 10 ? ? -174.60 30.69 176 17 ALA A 34 ? ? 176.05 -177.25 177 17 ASN A 52 ? ? -36.21 137.59 178 17 ARG A 53 ? ? -91.43 33.30 179 17 PRO A 79 ? ? -47.91 -177.65 180 17 ASP A 83 ? ? -32.67 104.04 181 17 LYS A 85 ? ? -175.28 -179.08 182 17 LYS A 93 ? ? -106.03 -129.80 183 18 HIS A 3 ? ? -179.49 146.54 184 18 HIS A 8 ? ? -51.96 -175.62 185 18 ASP A 10 ? ? -172.12 24.69 186 18 ASN A 16 ? ? 80.19 53.31 187 18 ALA A 34 ? ? 176.06 142.39 188 18 LEU A 36 ? ? -63.15 -174.49 189 18 ASN A 52 ? ? -33.92 130.19 190 18 ARG A 53 ? ? -78.76 24.18 191 18 PRO A 79 ? ? -48.55 -176.96 192 18 ASP A 83 ? ? -32.09 103.90 193 18 LYS A 85 ? ? -175.43 -179.23 194 18 ALA A 92 ? ? -47.44 170.85 195 18 LYS A 93 ? ? -153.53 -69.75 196 19 HIS A 4 ? ? -101.06 -76.65 197 19 HIS A 7 ? ? -144.02 11.05 198 19 ASP A 10 ? ? -172.59 27.19 199 19 ALA A 34 ? ? 173.12 -177.93 200 19 ASN A 52 ? ? -35.74 143.07 201 19 ARG A 53 ? ? -89.01 36.77 202 19 PRO A 79 ? ? -48.28 -175.92 203 19 ASP A 83 ? ? -31.35 103.90 204 19 LYS A 85 ? ? -177.85 -177.50 205 19 ALA A 92 ? ? -58.57 108.80 206 20 HIS A 6 ? ? -62.07 -176.79 207 20 ASP A 10 ? ? -176.04 29.83 208 20 ALA A 34 ? ? 171.36 138.31 209 20 LEU A 36 ? ? -52.12 -176.29 210 20 ILE A 44 ? ? -59.85 97.40 211 20 GLN A 50 ? ? 41.96 28.26 212 20 ASN A 52 ? ? -30.38 137.65 213 20 PRO A 79 ? ? -48.77 -175.81 214 20 ASP A 83 ? ? -33.49 104.06 215 20 LYS A 85 ? ? -174.06 -179.58 216 20 ALA A 92 ? ? -40.91 152.54 217 20 LYS A 93 ? ? 54.34 179.50 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LKZ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LKZ _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '40 mM sodium phosphate-1, 50 mM sodium chloride-2, 2 mM EDTA-3, 1 mM sodium azide-4, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '40 mM sodium phosphate-5, 50 mM sodium chloride-6, 2 mM EDTA-7, 1 mM sodium azide-8, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate-1' 40 ? mM ? 1 'sodium chloride-2' 50 ? mM ? 1 EDTA-3 2 ? mM ? 1 'sodium azide-4' 1 ? mM ? 1 'sodium phosphate-5' 40 ? mM ? 2 'sodium chloride-6' 50 ? mM ? 2 EDTA-7 2 ? mM ? 2 'sodium azide-8' 1 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D C(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D H(CCO)NH' 1 6 1 '3D HNCACB' 1 7 1 '3D HBHA(CO)NH' 1 8 1 '3D 1H-15N NOESY' 1 9 2 '2D 1H-13C HSQC' 1 10 2 '3D HCCH-COSY' 1 11 2 '3D HCCH-TOCSY' 1 12 2 '3D 1H-13C NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LKZ _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 58 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1474 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 306 _pdbx_nmr_constraints.NOE_long_range_total_count 433 _pdbx_nmr_constraints.NOE_medium_range_total_count 282 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 453 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2LKZ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 1 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRDraw 3 ? 'Laskowski and MacArthur' refinement ProcheckNMR 4 ? Goddard 'chemical shift assignment' Sparky 5 ? Goddard 'chemical shift calculation' Sparky 6 ? Goddard 'peak picking' Sparky 7 ? 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 8 ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLY N N N N 94 GLY CA C N N 95 GLY C C N N 96 GLY O O N N 97 GLY OXT O N N 98 GLY H H N N 99 GLY H2 H N N 100 GLY HA2 H N N 101 GLY HA3 H N N 102 GLY HXT H N N 103 HIS N N N N 104 HIS CA C N S 105 HIS C C N N 106 HIS O O N N 107 HIS CB C N N 108 HIS CG C Y N 109 HIS ND1 N Y N 110 HIS CD2 C Y N 111 HIS CE1 C Y N 112 HIS NE2 N Y N 113 HIS OXT O N N 114 HIS H H N N 115 HIS H2 H N N 116 HIS HA H N N 117 HIS HB2 H N N 118 HIS HB3 H N N 119 HIS HD1 H N N 120 HIS HD2 H N N 121 HIS HE1 H N N 122 HIS HE2 H N N 123 HIS HXT H N N 124 ILE N N N N 125 ILE CA C N S 126 ILE C C N N 127 ILE O O N N 128 ILE CB C N S 129 ILE CG1 C N N 130 ILE CG2 C N N 131 ILE CD1 C N N 132 ILE OXT O N N 133 ILE H H N N 134 ILE H2 H N N 135 ILE HA H N N 136 ILE HB H N N 137 ILE HG12 H N N 138 ILE HG13 H N N 139 ILE HG21 H N N 140 ILE HG22 H N N 141 ILE HG23 H N N 142 ILE HD11 H N N 143 ILE HD12 H N N 144 ILE HD13 H N N 145 ILE HXT H N N 146 LEU N N N N 147 LEU CA C N S 148 LEU C C N N 149 LEU O O N N 150 LEU CB C N N 151 LEU CG C N N 152 LEU CD1 C N N 153 LEU CD2 C N N 154 LEU OXT O N N 155 LEU H H N N 156 LEU H2 H N N 157 LEU HA H N N 158 LEU HB2 H N N 159 LEU HB3 H N N 160 LEU HG H N N 161 LEU HD11 H N N 162 LEU HD12 H N N 163 LEU HD13 H N N 164 LEU HD21 H N N 165 LEU HD22 H N N 166 LEU HD23 H N N 167 LEU HXT H N N 168 LYS N N N N 169 LYS CA C N S 170 LYS C C N N 171 LYS O O N N 172 LYS CB C N N 173 LYS CG C N N 174 LYS CD C N N 175 LYS CE C N N 176 LYS NZ N N N 177 LYS OXT O N N 178 LYS H H N N 179 LYS H2 H N N 180 LYS HA H N N 181 LYS HB2 H N N 182 LYS HB3 H N N 183 LYS HG2 H N N 184 LYS HG3 H N N 185 LYS HD2 H N N 186 LYS HD3 H N N 187 LYS HE2 H N N 188 LYS HE3 H N N 189 LYS HZ1 H N N 190 LYS HZ2 H N N 191 LYS HZ3 H N N 192 LYS HXT H N N 193 MET N N N N 194 MET CA C N S 195 MET C C N N 196 MET O O N N 197 MET CB C N N 198 MET CG C N N 199 MET SD S N N 200 MET CE C N N 201 MET OXT O N N 202 MET H H N N 203 MET H2 H N N 204 MET HA H N N 205 MET HB2 H N N 206 MET HB3 H N N 207 MET HG2 H N N 208 MET HG3 H N N 209 MET HE1 H N N 210 MET HE2 H N N 211 MET HE3 H N N 212 MET HXT H N N 213 PHE N N N N 214 PHE CA C N S 215 PHE C C N N 216 PHE O O N N 217 PHE CB C N N 218 PHE CG C Y N 219 PHE CD1 C Y N 220 PHE CD2 C Y N 221 PHE CE1 C Y N 222 PHE CE2 C Y N 223 PHE CZ C Y N 224 PHE OXT O N N 225 PHE H H N N 226 PHE H2 H N N 227 PHE HA H N N 228 PHE HB2 H N N 229 PHE HB3 H N N 230 PHE HD1 H N N 231 PHE HD2 H N N 232 PHE HE1 H N N 233 PHE HE2 H N N 234 PHE HZ H N N 235 PHE HXT H N N 236 PRO N N N N 237 PRO CA C N S 238 PRO C C N N 239 PRO O O N N 240 PRO CB C N N 241 PRO CG C N N 242 PRO CD C N N 243 PRO OXT O N N 244 PRO H H N N 245 PRO HA H N N 246 PRO HB2 H N N 247 PRO HB3 H N N 248 PRO HG2 H N N 249 PRO HG3 H N N 250 PRO HD2 H N N 251 PRO HD3 H N N 252 PRO HXT H N N 253 SER N N N N 254 SER CA C N S 255 SER C C N N 256 SER O O N N 257 SER CB C N N 258 SER OG O N N 259 SER OXT O N N 260 SER H H N N 261 SER H2 H N N 262 SER HA H N N 263 SER HB2 H N N 264 SER HB3 H N N 265 SER HG H N N 266 SER HXT H N N 267 THR N N N N 268 THR CA C N S 269 THR C C N N 270 THR O O N N 271 THR CB C N R 272 THR OG1 O N N 273 THR CG2 C N N 274 THR OXT O N N 275 THR H H N N 276 THR H2 H N N 277 THR HA H N N 278 THR HB H N N 279 THR HG1 H N N 280 THR HG21 H N N 281 THR HG22 H N N 282 THR HG23 H N N 283 THR HXT H N N 284 TYR N N N N 285 TYR CA C N S 286 TYR C C N N 287 TYR O O N N 288 TYR CB C N N 289 TYR CG C Y N 290 TYR CD1 C Y N 291 TYR CD2 C Y N 292 TYR CE1 C Y N 293 TYR CE2 C Y N 294 TYR CZ C Y N 295 TYR OH O N N 296 TYR OXT O N N 297 TYR H H N N 298 TYR H2 H N N 299 TYR HA H N N 300 TYR HB2 H N N 301 TYR HB3 H N N 302 TYR HD1 H N N 303 TYR HD2 H N N 304 TYR HE1 H N N 305 TYR HE2 H N N 306 TYR HH H N N 307 TYR HXT H N N 308 VAL N N N N 309 VAL CA C N S 310 VAL C C N N 311 VAL O O N N 312 VAL CB C N N 313 VAL CG1 C N N 314 VAL CG2 C N N 315 VAL OXT O N N 316 VAL H H N N 317 VAL H2 H N N 318 VAL HA H N N 319 VAL HB H N N 320 VAL HG11 H N N 321 VAL HG12 H N N 322 VAL HG13 H N N 323 VAL HG21 H N N 324 VAL HG22 H N N 325 VAL HG23 H N N 326 VAL HXT H N N 327 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLY N CA sing N N 89 GLY N H sing N N 90 GLY N H2 sing N N 91 GLY CA C sing N N 92 GLY CA HA2 sing N N 93 GLY CA HA3 sing N N 94 GLY C O doub N N 95 GLY C OXT sing N N 96 GLY OXT HXT sing N N 97 HIS N CA sing N N 98 HIS N H sing N N 99 HIS N H2 sing N N 100 HIS CA C sing N N 101 HIS CA CB sing N N 102 HIS CA HA sing N N 103 HIS C O doub N N 104 HIS C OXT sing N N 105 HIS CB CG sing N N 106 HIS CB HB2 sing N N 107 HIS CB HB3 sing N N 108 HIS CG ND1 sing Y N 109 HIS CG CD2 doub Y N 110 HIS ND1 CE1 doub Y N 111 HIS ND1 HD1 sing N N 112 HIS CD2 NE2 sing Y N 113 HIS CD2 HD2 sing N N 114 HIS CE1 NE2 sing Y N 115 HIS CE1 HE1 sing N N 116 HIS NE2 HE2 sing N N 117 HIS OXT HXT sing N N 118 ILE N CA sing N N 119 ILE N H sing N N 120 ILE N H2 sing N N 121 ILE CA C sing N N 122 ILE CA CB sing N N 123 ILE CA HA sing N N 124 ILE C O doub N N 125 ILE C OXT sing N N 126 ILE CB CG1 sing N N 127 ILE CB CG2 sing N N 128 ILE CB HB sing N N 129 ILE CG1 CD1 sing N N 130 ILE CG1 HG12 sing N N 131 ILE CG1 HG13 sing N N 132 ILE CG2 HG21 sing N N 133 ILE CG2 HG22 sing N N 134 ILE CG2 HG23 sing N N 135 ILE CD1 HD11 sing N N 136 ILE CD1 HD12 sing N N 137 ILE CD1 HD13 sing N N 138 ILE OXT HXT sing N N 139 LEU N CA sing N N 140 LEU N H sing N N 141 LEU N H2 sing N N 142 LEU CA C sing N N 143 LEU CA CB sing N N 144 LEU CA HA sing N N 145 LEU C O doub N N 146 LEU C OXT sing N N 147 LEU CB CG sing N N 148 LEU CB HB2 sing N N 149 LEU CB HB3 sing N N 150 LEU CG CD1 sing N N 151 LEU CG CD2 sing N N 152 LEU CG HG sing N N 153 LEU CD1 HD11 sing N N 154 LEU CD1 HD12 sing N N 155 LEU CD1 HD13 sing N N 156 LEU CD2 HD21 sing N N 157 LEU CD2 HD22 sing N N 158 LEU CD2 HD23 sing N N 159 LEU OXT HXT sing N N 160 LYS N CA sing N N 161 LYS N H sing N N 162 LYS N H2 sing N N 163 LYS CA C sing N N 164 LYS CA CB sing N N 165 LYS CA HA sing N N 166 LYS C O doub N N 167 LYS C OXT sing N N 168 LYS CB CG sing N N 169 LYS CB HB2 sing N N 170 LYS CB HB3 sing N N 171 LYS CG CD sing N N 172 LYS CG HG2 sing N N 173 LYS CG HG3 sing N N 174 LYS CD CE sing N N 175 LYS CD HD2 sing N N 176 LYS CD HD3 sing N N 177 LYS CE NZ sing N N 178 LYS CE HE2 sing N N 179 LYS CE HE3 sing N N 180 LYS NZ HZ1 sing N N 181 LYS NZ HZ2 sing N N 182 LYS NZ HZ3 sing N N 183 LYS OXT HXT sing N N 184 MET N CA sing N N 185 MET N H sing N N 186 MET N H2 sing N N 187 MET CA C sing N N 188 MET CA CB sing N N 189 MET CA HA sing N N 190 MET C O doub N N 191 MET C OXT sing N N 192 MET CB CG sing N N 193 MET CB HB2 sing N N 194 MET CB HB3 sing N N 195 MET CG SD sing N N 196 MET CG HG2 sing N N 197 MET CG HG3 sing N N 198 MET SD CE sing N N 199 MET CE HE1 sing N N 200 MET CE HE2 sing N N 201 MET CE HE3 sing N N 202 MET OXT HXT sing N N 203 PHE N CA sing N N 204 PHE N H sing N N 205 PHE N H2 sing N N 206 PHE CA C sing N N 207 PHE CA CB sing N N 208 PHE CA HA sing N N 209 PHE C O doub N N 210 PHE C OXT sing N N 211 PHE CB CG sing N N 212 PHE CB HB2 sing N N 213 PHE CB HB3 sing N N 214 PHE CG CD1 doub Y N 215 PHE CG CD2 sing Y N 216 PHE CD1 CE1 sing Y N 217 PHE CD1 HD1 sing N N 218 PHE CD2 CE2 doub Y N 219 PHE CD2 HD2 sing N N 220 PHE CE1 CZ doub Y N 221 PHE CE1 HE1 sing N N 222 PHE CE2 CZ sing Y N 223 PHE CE2 HE2 sing N N 224 PHE CZ HZ sing N N 225 PHE OXT HXT sing N N 226 PRO N CA sing N N 227 PRO N CD sing N N 228 PRO N H sing N N 229 PRO CA C sing N N 230 PRO CA CB sing N N 231 PRO CA HA sing N N 232 PRO C O doub N N 233 PRO C OXT sing N N 234 PRO CB CG sing N N 235 PRO CB HB2 sing N N 236 PRO CB HB3 sing N N 237 PRO CG CD sing N N 238 PRO CG HG2 sing N N 239 PRO CG HG3 sing N N 240 PRO CD HD2 sing N N 241 PRO CD HD3 sing N N 242 PRO OXT HXT sing N N 243 SER N CA sing N N 244 SER N H sing N N 245 SER N H2 sing N N 246 SER CA C sing N N 247 SER CA CB sing N N 248 SER CA HA sing N N 249 SER C O doub N N 250 SER C OXT sing N N 251 SER CB OG sing N N 252 SER CB HB2 sing N N 253 SER CB HB3 sing N N 254 SER OG HG sing N N 255 SER OXT HXT sing N N 256 THR N CA sing N N 257 THR N H sing N N 258 THR N H2 sing N N 259 THR CA C sing N N 260 THR CA CB sing N N 261 THR CA HA sing N N 262 THR C O doub N N 263 THR C OXT sing N N 264 THR CB OG1 sing N N 265 THR CB CG2 sing N N 266 THR CB HB sing N N 267 THR OG1 HG1 sing N N 268 THR CG2 HG21 sing N N 269 THR CG2 HG22 sing N N 270 THR CG2 HG23 sing N N 271 THR OXT HXT sing N N 272 TYR N CA sing N N 273 TYR N H sing N N 274 TYR N H2 sing N N 275 TYR CA C sing N N 276 TYR CA CB sing N N 277 TYR CA HA sing N N 278 TYR C O doub N N 279 TYR C OXT sing N N 280 TYR CB CG sing N N 281 TYR CB HB2 sing N N 282 TYR CB HB3 sing N N 283 TYR CG CD1 doub Y N 284 TYR CG CD2 sing Y N 285 TYR CD1 CE1 sing Y N 286 TYR CD1 HD1 sing N N 287 TYR CD2 CE2 doub Y N 288 TYR CD2 HD2 sing N N 289 TYR CE1 CZ doub Y N 290 TYR CE1 HE1 sing N N 291 TYR CE2 CZ sing Y N 292 TYR CE2 HE2 sing N N 293 TYR CZ OH sing N N 294 TYR OH HH sing N N 295 TYR OXT HXT sing N N 296 VAL N CA sing N N 297 VAL N H sing N N 298 VAL N H2 sing N N 299 VAL CA C sing N N 300 VAL CA CB sing N N 301 VAL CA HA sing N N 302 VAL C O doub N N 303 VAL C OXT sing N N 304 VAL CB CG1 sing N N 305 VAL CB CG2 sing N N 306 VAL CB HB sing N N 307 VAL CG1 HG11 sing N N 308 VAL CG1 HG12 sing N N 309 VAL CG1 HG13 sing N N 310 VAL CG2 HG21 sing N N 311 VAL CG2 HG22 sing N N 312 VAL CG2 HG23 sing N N 313 VAL OXT HXT sing N N 314 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DMX' # _atom_sites.entry_id 2LKZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #