data_2LL8 # _entry.id 2LL8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LL8 pdb_00002ll8 10.2210/pdb2ll8/pdb RCSB RCSB102518 ? ? BMRB 18032 ? ? WWPDB D_1000102518 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18032 BMRB unspecified . RpR324 TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LL8 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-10-31 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ramelot, T.A.' 1 'Ni, S.' 2 'Rossi, P.' 3 'Yang, Y.' 4 'Wang, H.' 5 'Ciccosanti, C.' 6 'Maglaqui, M.' 7 'Janjua, H.' 8 'Nair, R.' 9 'Roset, B.' 10 'Acton, T.B.' 11 'Xiao, R.' 12 'Everett, J.K.' 13 'Prestegard, J.H.' 14 'Montelione, G.T.' 15 'Kennedy, M.A.' 16 'Northeast Structural Genomics Consortium (NESG)' 17 # _citation.id primary _citation.title ;Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long-chain fatty acids in open and closed conformations. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 51 _citation.page_first 7239 _citation.page_last 7249 _citation.year 2012 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22876860 _citation.pdbx_database_id_DOI 10.1021/bi300546b # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ramelot, T.A.' 1 ? primary 'Rossi, P.' 2 ? primary 'Forouhar, F.' 3 ? primary 'Lee, H.W.' 4 ? primary 'Yang, Y.' 5 ? primary 'Ni, S.' 6 ? primary 'Unser, S.' 7 ? primary 'Lew, S.' 8 ? primary 'Seetharaman, J.' 9 ? primary 'Xiao, R.' 10 ? primary 'Acton, T.B.' 11 ? primary 'Everett, J.K.' 12 ? primary 'Prestegard, J.H.' 13 ? primary 'Hunt, J.F.' 14 ? primary 'Montelione, G.T.' 15 ? primary 'Kennedy, M.A.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Specialized acyl carrier protein' 11309.719 1 ? ? ? ? 2 non-polymer syn "4'-PHOSPHOPANTETHEINE" 358.348 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNL AARIDELVAAKGALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNL AARIDELVAAKGALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier RpR324 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 SER n 1 4 THR n 1 5 PHE n 1 6 ASP n 1 7 ARG n 1 8 VAL n 1 9 ALA n 1 10 THR n 1 11 ILE n 1 12 ILE n 1 13 ALA n 1 14 GLU n 1 15 THR n 1 16 CYS n 1 17 ASP n 1 18 ILE n 1 19 PRO n 1 20 ARG n 1 21 GLU n 1 22 THR n 1 23 ILE n 1 24 THR n 1 25 PRO n 1 26 GLU n 1 27 SER n 1 28 HIS n 1 29 ALA n 1 30 ILE n 1 31 ASP n 1 32 ASP n 1 33 LEU n 1 34 GLY n 1 35 ILE n 1 36 ASP n 1 37 SER n 1 38 LEU n 1 39 ASP n 1 40 PHE n 1 41 LEU n 1 42 ASP n 1 43 ILE n 1 44 ALA n 1 45 PHE n 1 46 ALA n 1 47 ILE n 1 48 ASP n 1 49 LYS n 1 50 ALA n 1 51 PHE n 1 52 GLY n 1 53 ILE n 1 54 LYS n 1 55 LEU n 1 56 PRO n 1 57 LEU n 1 58 GLU n 1 59 LYS n 1 60 TRP n 1 61 THR n 1 62 GLN n 1 63 GLU n 1 64 VAL n 1 65 ASN n 1 66 ASP n 1 67 GLY n 1 68 LYS n 1 69 ALA n 1 70 THR n 1 71 THR n 1 72 GLU n 1 73 GLN n 1 74 TYR n 1 75 PHE n 1 76 VAL n 1 77 LEU n 1 78 LYS n 1 79 ASN n 1 80 LEU n 1 81 ALA n 1 82 ALA n 1 83 ARG n 1 84 ILE n 1 85 ASP n 1 86 GLU n 1 87 LEU n 1 88 VAL n 1 89 ALA n 1 90 ALA n 1 91 LYS n 1 92 GLY n 1 93 ALA n 1 94 LEU n 1 95 GLU n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n 1 100 HIS n 1 101 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene RPA2022 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rhodopseudomonas palustris' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1076 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET21-NESG _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6N882_RHOPA _struct_ref.pdbx_db_accession Q6N882 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNL AARIDELVAAKGA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LL8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 93 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6N882 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 93 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 93 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LL8 LEU A 94 ? UNP Q6N882 ? ? 'expression tag' 94 1 1 2LL8 GLU A 95 ? UNP Q6N882 ? ? 'expression tag' 95 2 1 2LL8 HIS A 96 ? UNP Q6N882 ? ? 'expression tag' 96 3 1 2LL8 HIS A 97 ? UNP Q6N882 ? ? 'expression tag' 97 4 1 2LL8 HIS A 98 ? UNP Q6N882 ? ? 'expression tag' 98 5 1 2LL8 HIS A 99 ? UNP Q6N882 ? ? 'expression tag' 99 6 1 2LL8 HIS A 100 ? UNP Q6N882 ? ? 'expression tag' 100 7 1 2LL8 HIS A 101 ? UNP Q6N882 ? ? 'expression tag' 101 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PNS non-polymer . "4'-PHOSPHOPANTETHEINE" ? 'C11 H23 N2 O7 P S' 358.348 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 3 '2D 1H-15N HSQC' 1 5 3 '2D 1H-13C HSQC' 1 6 2 '2D 1H-13C HSQC-CT' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY_aliph' 1 9 1 '3D HNCO' 1 10 1 '3D HNCACB' 1 11 1 '3D CBCA(CO)NH' 1 12 1 '3D 1H-13C NOESY_arom' 1 13 1 '3D HN(CO)CA' 1 14 1 '3D HBHA(CO)NH' 1 15 1 '3D C(CCO)NH' 1 16 3 '3D HCCH-COSY' 1 17 1 '3D HCCH-TOCSY' 1 18 3 '3D CCH-TOCSY' 1 19 3 '4D CC-NOESY' 1 20 1 '2D 1H-13C HSQC aromatic' 1 21 2 '2D 1H-15N hetNOE' 1 22 2 '2D 1H-15N HSQC_His' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1.0 mM [U-100% 13C; U-100% 15N] protein, 20 mM MES, 200 mM sodium chloride, 5 mM calcium chloride, 0.02 % sodium azide, 10 mM DTT, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;1.0 mM U-100% 15N and 5% 13C biosynthetically directed protein, 20 mM MES, 200 mM sodium chloride, 5 mM calcium chloride, 10 mM DTT, 0.02 % sodium azide, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' ;1.0 mM [U-100% 13C; U-100% 15N] protein, 20 mM MES, 200 mM sodium chloride, 5 mM calcium chloride, 0.02 % sodium azide, 10 mM DTT, 100% D2O ; 3 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 850 Bruker 'AVANCE III' 2 'Bruker Avance III' # _pdbx_nmr_refine.entry_id 2LL8 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'CNS water refinement + RDCs' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LL8 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LL8 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2008 1 Varian collection VNMR 6.1C 2 'Bruker Biospin' collection TopSpin 2.1.4 3 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.2.1 4 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 2.25 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.3 6 Goddard 'data analysis' Sparky 3.113 7 'Bhattacharya and Montelione' refinement PSVS 1.4 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.30 9 '(PdbStat)-Roberto Tejero and Gaetano T. Montelione' 'structure solution' PdbStat 5.4 10 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift autoassignment' 'PINE Server' 1.0 11 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 12 'Alex Lemak, University of Toronto' refinement FMCGUI ? 13 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LL8 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LL8 _struct.title ;Solution NMR structure of the specialized holo-acyl carrier protein RPA2022 from Rhodopseudomonas palustris refined with NH RDCs, Northeast Structural Genomics Consortium Target RpR324 ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LL8 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'holo, Structural Genomics, PSI-Biology, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? ASP A 17 ? SER A 3 ASP A 17 1 ? 15 HELX_P HELX_P2 2 PRO A 19 ? ILE A 23 ? PRO A 19 ILE A 23 5 ? 5 HELX_P HELX_P3 3 ASP A 36 ? GLY A 52 ? ASP A 36 GLY A 52 1 ? 17 HELX_P HELX_P4 4 PRO A 56 ? ASP A 66 ? PRO A 56 ASP A 66 1 ? 11 HELX_P HELX_P5 5 THR A 71 ? VAL A 76 ? THR A 71 VAL A 76 1 ? 6 HELX_P HELX_P6 6 VAL A 76 ? GLY A 92 ? VAL A 76 GLY A 92 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 37 _struct_conn.ptnr1_label_atom_id OG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id PNS _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id P24 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 37 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id PNS _struct_conn.ptnr2_auth_seq_id 102 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.602 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id PNS _struct_site.pdbx_auth_seq_id 102 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE PNS A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ASP A 36 ? ASP A 36 . ? 1_555 ? 2 AC1 2 SER A 37 ? SER A 37 . ? 1_555 ? # _atom_sites.entry_id 2LL8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 TRP 60 60 60 TRP TRP A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 HIS 101 101 101 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id PNS _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 102 _pdbx_nonpoly_scheme.auth_seq_num 102 _pdbx_nonpoly_scheme.pdb_mon_id PNS _pdbx_nonpoly_scheme.auth_mon_id PNS _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-11-30 2 'Structure model' 1 1 2012-02-22 3 'Structure model' 1 2 2012-12-05 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' 6 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 4 'Structure model' '_struct_ref_seq_dif.details' 8 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 9 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 10 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 1.0 ? mM '[U-100% 13C; U-100% 15N]' 1 MES-2 20 ? mM ? 1 'sodium chloride-3' 200 ? mM ? 1 'calcium chloride-4' 5 ? mM ? 1 'sodium azide-5' 0.02 ? % ? 1 DTT-6 10 ? mM ? 1 protein-7 1.0 ? mM 'U-100% 15N and 5% 13C biosynthetically directed' 2 MES-8 20 ? mM ? 2 'sodium chloride-9' 200 ? mM ? 2 'calcium chloride-10' 5 ? mM ? 2 DTT-11 10 ? mM ? 2 'sodium azide-12' 0.02 ? % ? 2 protein-13 1.0 ? mM '[U-100% 13C; U-100% 15N]' 3 MES-14 20 ? mM ? 3 'sodium chloride-15' 200 ? mM ? 3 'calcium chloride-16' 5 ? mM ? 3 'sodium azide-17' 0.02 ? % ? 3 DTT-18 10 ? mM ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 13 OG A SER 37 ? ? O25 A PNS 102 ? ? 1.26 2 14 OG A SER 37 ? ? O25 A PNS 102 ? ? 1.23 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 53 ? ? -112.86 -169.52 2 1 LEU A 94 ? ? 48.10 -167.22 3 1 HIS A 97 ? ? 68.28 165.73 4 1 HIS A 98 ? ? -72.39 -80.29 5 2 HIS A 96 ? ? -64.84 98.47 6 2 HIS A 100 ? ? 77.89 -45.77 7 3 THR A 2 ? ? 47.76 82.11 8 3 ASP A 17 ? ? 49.70 73.03 9 3 ASP A 32 ? ? -103.35 -61.59 10 3 PRO A 56 ? ? -66.97 61.91 11 3 LEU A 94 ? ? 59.44 -166.07 12 3 HIS A 96 ? ? 54.42 78.78 13 3 HIS A 97 ? ? -107.27 -78.95 14 3 HIS A 99 ? ? 62.44 -157.52 15 3 HIS A 100 ? ? 64.25 -162.75 16 4 ILE A 53 ? ? -127.39 -165.53 17 4 ALA A 93 ? ? 160.14 1.18 18 4 HIS A 96 ? ? 64.64 116.63 19 4 HIS A 100 ? ? -66.22 93.36 20 5 HIS A 98 ? ? -126.05 -55.55 21 5 HIS A 99 ? ? 54.23 74.55 22 5 HIS A 100 ? ? -54.08 108.23 23 6 ASP A 32 ? ? -105.24 -66.72 24 6 HIS A 96 ? ? 66.48 -76.31 25 6 HIS A 97 ? ? 77.00 -34.34 26 6 HIS A 98 ? ? 69.77 101.66 27 7 THR A 2 ? ? -160.47 117.34 28 7 SER A 3 ? ? 178.54 172.39 29 7 ALA A 93 ? ? 174.62 123.19 30 7 HIS A 96 ? ? -177.20 12.12 31 7 HIS A 97 ? ? 76.46 162.88 32 7 HIS A 98 ? ? 90.32 -32.14 33 7 HIS A 99 ? ? 72.79 108.10 34 8 HIS A 96 ? ? 59.92 19.37 35 8 HIS A 100 ? ? -166.39 -63.15 36 9 ASP A 32 ? ? -120.32 -62.33 37 9 LEU A 94 ? ? 57.05 -167.82 38 9 HIS A 98 ? ? -81.95 -70.40 39 9 HIS A 99 ? ? 73.49 -54.67 40 10 THR A 2 ? ? -66.59 98.57 41 10 ASP A 17 ? ? 49.41 70.96 42 10 ASP A 32 ? ? -98.42 -61.98 43 10 PHE A 75 ? ? -140.24 16.95 44 10 HIS A 100 ? ? -168.12 -39.66 45 11 ASP A 32 ? ? -90.14 -63.74 46 11 LEU A 94 ? ? 80.30 130.62 47 11 HIS A 97 ? ? 65.48 -74.59 48 11 HIS A 100 ? ? 66.23 96.92 49 12 ASP A 31 ? ? -109.33 44.96 50 12 ASP A 32 ? ? -169.15 -65.64 51 12 PRO A 56 ? ? -64.56 55.75 52 12 LEU A 94 ? ? 62.85 -169.29 53 12 HIS A 97 ? ? -69.33 80.57 54 12 HIS A 100 ? ? -82.12 38.76 55 13 GLU A 95 ? ? -145.60 15.98 56 13 HIS A 100 ? ? -103.50 -65.58 57 14 THR A 2 ? ? 63.46 73.07 58 14 ALA A 93 ? ? -158.57 -53.86 59 14 HIS A 96 ? ? -172.20 136.61 60 14 HIS A 99 ? ? 69.19 137.60 61 15 PRO A 56 ? ? -76.19 46.48 62 15 LEU A 94 ? ? 58.29 107.16 63 15 HIS A 98 ? ? 64.66 86.20 64 16 SER A 3 ? ? 21.94 -90.21 65 16 ALA A 93 ? ? -143.72 -43.14 66 16 HIS A 99 ? ? 62.85 97.25 67 16 HIS A 100 ? ? -87.19 42.92 68 17 ASP A 17 ? ? 55.46 72.83 69 17 ALA A 93 ? ? -175.85 108.10 70 17 HIS A 96 ? ? 71.70 -67.69 71 17 HIS A 97 ? ? -172.70 -171.76 72 17 HIS A 98 ? ? -65.60 83.38 73 18 ASP A 32 ? ? -126.00 -59.26 74 18 HIS A 96 ? ? -96.71 33.34 75 18 HIS A 99 ? ? 64.02 85.59 76 19 ASP A 17 ? ? 52.50 71.53 77 19 GLU A 95 ? ? -63.00 92.14 78 19 HIS A 97 ? ? 68.09 119.59 79 19 HIS A 98 ? ? -64.92 91.17 80 20 HIS A 99 ? ? -168.27 82.76 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name "4'-PHOSPHOPANTETHEINE" _pdbx_entity_nonpoly.comp_id PNS #