data_2LLL # _entry.id 2LLL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LLL pdb_00002lll 10.2210/pdb2lll/pdb RCSB RCSB102531 ? ? BMRB 18053 ? 10.13018/BMR18053 WWPDB D_1000102531 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-12-07 2 'Structure model' 1 1 2011-12-14 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_ref_seq_dif.details' 7 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LLL _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-11-11 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18053 BMRB unspecified . HR8546A TargetDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lemak, A.' 1 'Yee, A.' 2 'Houliston, S.' 3 'Garcia, M.' 4 'Xu, C.' 5 'Min, J.' 6 'Montelione, G.T.' 7 'Arrowsmith, C.' 8 'Northeast Structural Genomics Consortium (NESG)' 9 'Structural Genomics Consortium (SGC)' 10 'Chaperone-Enabled Studies of Epigenetic Regulation Enzymes (CEBS)' 11 # _citation.id primary _citation.title 'NMR solution structure of c-terminal globular domain of human Lamin-B2' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lemak, A.' 1 ? primary 'Yee, A.' 2 ? primary 'Houliston, S.' 3 ? primary 'Garcia, M.' 4 ? primary 'Xu, C.' 5 ? primary 'Min, J.' 6 ? primary 'Montelione, G.T.' 7 ? primary 'Arrowsmith, C.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Lamin-B2 _entity.formula_weight 15476.248 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 449-569' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGRENLYFQGSASGSVSIEEIDLEGKFVQLKNNSDKDQSLGNWRIKRQVLEGEEIAYKFTPKYILRAGQMVT VWAAGAGVAHSPPSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENG ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGRENLYFQGSASGSVSIEEIDLEGKFVQLKNNSDKDQSLGNWRIKRQVLEGEEIAYKFTPKYILRAGQMVT VWAAGAGVAHSPPSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier HR8546A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 ARG n 1 12 GLU n 1 13 ASN n 1 14 LEU n 1 15 TYR n 1 16 PHE n 1 17 GLN n 1 18 GLY n 1 19 SER n 1 20 ALA n 1 21 SER n 1 22 GLY n 1 23 SER n 1 24 VAL n 1 25 SER n 1 26 ILE n 1 27 GLU n 1 28 GLU n 1 29 ILE n 1 30 ASP n 1 31 LEU n 1 32 GLU n 1 33 GLY n 1 34 LYS n 1 35 PHE n 1 36 VAL n 1 37 GLN n 1 38 LEU n 1 39 LYS n 1 40 ASN n 1 41 ASN n 1 42 SER n 1 43 ASP n 1 44 LYS n 1 45 ASP n 1 46 GLN n 1 47 SER n 1 48 LEU n 1 49 GLY n 1 50 ASN n 1 51 TRP n 1 52 ARG n 1 53 ILE n 1 54 LYS n 1 55 ARG n 1 56 GLN n 1 57 VAL n 1 58 LEU n 1 59 GLU n 1 60 GLY n 1 61 GLU n 1 62 GLU n 1 63 ILE n 1 64 ALA n 1 65 TYR n 1 66 LYS n 1 67 PHE n 1 68 THR n 1 69 PRO n 1 70 LYS n 1 71 TYR n 1 72 ILE n 1 73 LEU n 1 74 ARG n 1 75 ALA n 1 76 GLY n 1 77 GLN n 1 78 MET n 1 79 VAL n 1 80 THR n 1 81 VAL n 1 82 TRP n 1 83 ALA n 1 84 ALA n 1 85 GLY n 1 86 ALA n 1 87 GLY n 1 88 VAL n 1 89 ALA n 1 90 HIS n 1 91 SER n 1 92 PRO n 1 93 PRO n 1 94 SER n 1 95 THR n 1 96 LEU n 1 97 VAL n 1 98 TRP n 1 99 LYS n 1 100 GLY n 1 101 GLN n 1 102 SER n 1 103 SER n 1 104 TRP n 1 105 GLY n 1 106 THR n 1 107 GLY n 1 108 GLU n 1 109 SER n 1 110 PHE n 1 111 ARG n 1 112 THR n 1 113 VAL n 1 114 LEU n 1 115 VAL n 1 116 ASN n 1 117 ALA n 1 118 ASP n 1 119 GLY n 1 120 GLU n 1 121 GLU n 1 122 VAL n 1 123 ALA n 1 124 MET n 1 125 ARG n 1 126 THR n 1 127 VAL n 1 128 LYS n 1 129 LYS n 1 130 SER n 1 131 SER n 1 132 VAL n 1 133 MET n 1 134 ARG n 1 135 GLU n 1 136 ASN n 1 137 GLU n 1 138 ASN n 1 139 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'LMNB2, LMN2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET28b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 431 ? ? ? A . n A 1 2 HIS 2 432 ? ? ? A . n A 1 3 HIS 3 433 ? ? ? A . n A 1 4 HIS 4 434 ? ? ? A . n A 1 5 HIS 5 435 ? ? ? A . n A 1 6 HIS 6 436 ? ? ? A . n A 1 7 HIS 7 437 ? ? ? A . n A 1 8 SER 8 438 ? ? ? A . n A 1 9 SER 9 439 ? ? ? A . n A 1 10 GLY 10 440 ? ? ? A . n A 1 11 ARG 11 441 ? ? ? A . n A 1 12 GLU 12 442 ? ? ? A . n A 1 13 ASN 13 443 ? ? ? A . n A 1 14 LEU 14 444 ? ? ? A . n A 1 15 TYR 15 445 ? ? ? A . n A 1 16 PHE 16 446 ? ? ? A . n A 1 17 GLN 17 447 ? ? ? A . n A 1 18 GLY 18 448 ? ? ? A . n A 1 19 SER 19 449 449 SER SER A . n A 1 20 ALA 20 450 450 ALA ALA A . n A 1 21 SER 21 451 451 SER SER A . n A 1 22 GLY 22 452 452 GLY GLY A . n A 1 23 SER 23 453 453 SER SER A . n A 1 24 VAL 24 454 454 VAL VAL A . n A 1 25 SER 25 455 455 SER SER A . n A 1 26 ILE 26 456 456 ILE ILE A . n A 1 27 GLU 27 457 457 GLU GLU A . n A 1 28 GLU 28 458 458 GLU GLU A . n A 1 29 ILE 29 459 459 ILE ILE A . n A 1 30 ASP 30 460 460 ASP ASP A . n A 1 31 LEU 31 461 461 LEU LEU A . n A 1 32 GLU 32 462 462 GLU GLU A . n A 1 33 GLY 33 463 463 GLY GLY A . n A 1 34 LYS 34 464 464 LYS LYS A . n A 1 35 PHE 35 465 465 PHE PHE A . n A 1 36 VAL 36 466 466 VAL VAL A . n A 1 37 GLN 37 467 467 GLN GLN A . n A 1 38 LEU 38 468 468 LEU LEU A . n A 1 39 LYS 39 469 469 LYS LYS A . n A 1 40 ASN 40 470 470 ASN ASN A . n A 1 41 ASN 41 471 471 ASN ASN A . n A 1 42 SER 42 472 472 SER SER A . n A 1 43 ASP 43 473 473 ASP ASP A . n A 1 44 LYS 44 474 474 LYS LYS A . n A 1 45 ASP 45 475 475 ASP ASP A . n A 1 46 GLN 46 476 476 GLN GLN A . n A 1 47 SER 47 477 477 SER SER A . n A 1 48 LEU 48 478 478 LEU LEU A . n A 1 49 GLY 49 479 479 GLY GLY A . n A 1 50 ASN 50 480 480 ASN ASN A . n A 1 51 TRP 51 481 481 TRP TRP A . n A 1 52 ARG 52 482 482 ARG ARG A . n A 1 53 ILE 53 483 483 ILE ILE A . n A 1 54 LYS 54 484 484 LYS LYS A . n A 1 55 ARG 55 485 485 ARG ARG A . n A 1 56 GLN 56 486 486 GLN GLN A . n A 1 57 VAL 57 487 487 VAL VAL A . n A 1 58 LEU 58 488 488 LEU LEU A . n A 1 59 GLU 59 489 489 GLU GLU A . n A 1 60 GLY 60 490 490 GLY GLY A . n A 1 61 GLU 61 491 491 GLU GLU A . n A 1 62 GLU 62 492 492 GLU GLU A . n A 1 63 ILE 63 493 493 ILE ILE A . n A 1 64 ALA 64 494 494 ALA ALA A . n A 1 65 TYR 65 495 495 TYR TYR A . n A 1 66 LYS 66 496 496 LYS LYS A . n A 1 67 PHE 67 497 497 PHE PHE A . n A 1 68 THR 68 498 498 THR THR A . n A 1 69 PRO 69 499 499 PRO PRO A . n A 1 70 LYS 70 500 500 LYS LYS A . n A 1 71 TYR 71 501 501 TYR TYR A . n A 1 72 ILE 72 502 502 ILE ILE A . n A 1 73 LEU 73 503 503 LEU LEU A . n A 1 74 ARG 74 504 504 ARG ARG A . n A 1 75 ALA 75 505 505 ALA ALA A . n A 1 76 GLY 76 506 506 GLY GLY A . n A 1 77 GLN 77 507 507 GLN GLN A . n A 1 78 MET 78 508 508 MET MET A . n A 1 79 VAL 79 509 509 VAL VAL A . n A 1 80 THR 80 510 510 THR THR A . n A 1 81 VAL 81 511 511 VAL VAL A . n A 1 82 TRP 82 512 512 TRP TRP A . n A 1 83 ALA 83 513 513 ALA ALA A . n A 1 84 ALA 84 514 514 ALA ALA A . n A 1 85 GLY 85 515 515 GLY GLY A . n A 1 86 ALA 86 516 516 ALA ALA A . n A 1 87 GLY 87 517 517 GLY GLY A . n A 1 88 VAL 88 518 518 VAL VAL A . n A 1 89 ALA 89 519 519 ALA ALA A . n A 1 90 HIS 90 520 520 HIS HIS A . n A 1 91 SER 91 521 521 SER SER A . n A 1 92 PRO 92 522 522 PRO PRO A . n A 1 93 PRO 93 523 523 PRO PRO A . n A 1 94 SER 94 524 524 SER SER A . n A 1 95 THR 95 525 525 THR THR A . n A 1 96 LEU 96 526 526 LEU LEU A . n A 1 97 VAL 97 527 527 VAL VAL A . n A 1 98 TRP 98 528 528 TRP TRP A . n A 1 99 LYS 99 529 529 LYS LYS A . n A 1 100 GLY 100 530 530 GLY GLY A . n A 1 101 GLN 101 531 531 GLN GLN A . n A 1 102 SER 102 532 532 SER SER A . n A 1 103 SER 103 533 533 SER SER A . n A 1 104 TRP 104 534 534 TRP TRP A . n A 1 105 GLY 105 535 535 GLY GLY A . n A 1 106 THR 106 536 536 THR THR A . n A 1 107 GLY 107 537 537 GLY GLY A . n A 1 108 GLU 108 538 538 GLU GLU A . n A 1 109 SER 109 539 539 SER SER A . n A 1 110 PHE 110 540 540 PHE PHE A . n A 1 111 ARG 111 541 541 ARG ARG A . n A 1 112 THR 112 542 542 THR THR A . n A 1 113 VAL 113 543 543 VAL VAL A . n A 1 114 LEU 114 544 544 LEU LEU A . n A 1 115 VAL 115 545 545 VAL VAL A . n A 1 116 ASN 116 546 546 ASN ASN A . n A 1 117 ALA 117 547 547 ALA ALA A . n A 1 118 ASP 118 548 548 ASP ASP A . n A 1 119 GLY 119 549 549 GLY GLY A . n A 1 120 GLU 120 550 550 GLU GLU A . n A 1 121 GLU 121 551 551 GLU GLU A . n A 1 122 VAL 122 552 552 VAL VAL A . n A 1 123 ALA 123 553 553 ALA ALA A . n A 1 124 MET 124 554 554 MET MET A . n A 1 125 ARG 125 555 555 ARG ARG A . n A 1 126 THR 126 556 556 THR THR A . n A 1 127 VAL 127 557 557 VAL VAL A . n A 1 128 LYS 128 558 558 LYS LYS A . n A 1 129 LYS 129 559 559 LYS LYS A . n A 1 130 SER 130 560 560 SER SER A . n A 1 131 SER 131 561 561 SER SER A . n A 1 132 VAL 132 562 562 VAL VAL A . n A 1 133 MET 133 563 563 MET MET A . n A 1 134 ARG 134 564 564 ARG ARG A . n A 1 135 GLU 135 565 565 GLU GLU A . n A 1 136 ASN 136 566 566 ASN ASN A . n A 1 137 GLU 137 567 567 GLU GLU A . n A 1 138 ASN 138 568 568 ASN ASN A . n A 1 139 GLY 139 569 569 GLY GLY A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LLL _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LLL _struct.title 'Solution NMR structure of C-terminal globular domain of human Lamin-B2, Northeast Structural Genomics Consortium target HR8546A' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LLL _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text ;immunoglobulin-like fold, structural protein, NESG, Northeast structural genomics consortium, SGC, Structural Genomics Consortium, Chaperone-Enabled Studies of Epigenetic Regulation Enzymes, CEBS, PSI-Biology ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LMNB2_HUMAN _struct_ref.pdbx_db_accession Q03252 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SASGSVSIEEIDLEGKFVQLKNNSDKDQSLGNWRIKRQVLEGEEIAYKFTPKYILRAGQMVTVWAAGAGVAHSPPSTLVW KGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENG ; _struct_ref.pdbx_align_begin 449 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LLL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 19 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 139 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q03252 _struct_ref_seq.db_align_beg 449 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 569 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 449 _struct_ref_seq.pdbx_auth_seq_align_end 569 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LLL MET A 1 ? UNP Q03252 ? ? 'expression tag' 431 1 1 2LLL HIS A 2 ? UNP Q03252 ? ? 'expression tag' 432 2 1 2LLL HIS A 3 ? UNP Q03252 ? ? 'expression tag' 433 3 1 2LLL HIS A 4 ? UNP Q03252 ? ? 'expression tag' 434 4 1 2LLL HIS A 5 ? UNP Q03252 ? ? 'expression tag' 435 5 1 2LLL HIS A 6 ? UNP Q03252 ? ? 'expression tag' 436 6 1 2LLL HIS A 7 ? UNP Q03252 ? ? 'expression tag' 437 7 1 2LLL SER A 8 ? UNP Q03252 ? ? 'expression tag' 438 8 1 2LLL SER A 9 ? UNP Q03252 ? ? 'expression tag' 439 9 1 2LLL GLY A 10 ? UNP Q03252 ? ? 'expression tag' 440 10 1 2LLL ARG A 11 ? UNP Q03252 ? ? 'expression tag' 441 11 1 2LLL GLU A 12 ? UNP Q03252 ? ? 'expression tag' 442 12 1 2LLL ASN A 13 ? UNP Q03252 ? ? 'expression tag' 443 13 1 2LLL LEU A 14 ? UNP Q03252 ? ? 'expression tag' 444 14 1 2LLL TYR A 15 ? UNP Q03252 ? ? 'expression tag' 445 15 1 2LLL PHE A 16 ? UNP Q03252 ? ? 'expression tag' 446 16 1 2LLL GLN A 17 ? UNP Q03252 ? ? 'expression tag' 447 17 1 2LLL GLY A 18 ? UNP Q03252 ? ? 'expression tag' 448 18 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details 'MONOMERIC, based on N15 relaxation data' # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 85 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 87 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 515 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 517 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 1 -2.71 2 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 2 4.63 3 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 3 -1.15 4 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 4 4.15 5 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 5 -0.75 6 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 6 0.98 7 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 7 -2.23 8 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 8 6.05 9 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 9 -0.44 10 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 10 2.52 11 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 11 1.66 12 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 12 -1.92 13 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 13 3.82 14 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 14 3.87 15 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 15 1.40 16 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 16 3.93 17 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 17 -0.14 18 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 18 0.71 19 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 19 -2.62 20 PRO 92 A . ? PRO 522 A PRO 93 A ? PRO 523 A 20 -1.61 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? C ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 24 ? ILE A 29 ? VAL A 454 ILE A 459 A 2 PHE A 35 ? ASN A 40 ? PHE A 465 ASN A 470 A 3 MET A 78 ? ALA A 83 ? MET A 508 ALA A 513 A 4 THR A 95 ? TRP A 98 ? THR A 525 TRP A 528 B 1 GLN A 46 ? SER A 47 ? GLN A 476 SER A 477 B 2 ILE A 72 ? LEU A 73 ? ILE A 502 LEU A 503 C 1 GLU A 62 ? LYS A 66 ? GLU A 492 LYS A 496 C 2 ARG A 52 ? VAL A 57 ? ARG A 482 VAL A 487 C 3 SER A 109 ? VAL A 115 ? SER A 539 VAL A 545 C 4 GLU A 121 ? LYS A 128 ? GLU A 551 LYS A 558 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 25 ? N SER A 455 O LYS A 39 ? O LYS A 469 A 2 3 N LEU A 38 ? N LEU A 468 O VAL A 79 ? O VAL A 509 A 3 4 N TRP A 82 ? N TRP A 512 O TRP A 98 ? O TRP A 528 B 1 2 N GLN A 46 ? N GLN A 476 O LEU A 73 ? O LEU A 503 C 1 2 O TYR A 65 ? O TYR A 495 N ILE A 53 ? N ILE A 483 C 2 3 N LYS A 54 ? N LYS A 484 O VAL A 113 ? O VAL A 543 C 3 4 N LEU A 114 ? N LEU A 544 O ALA A 123 ? O ALA A 553 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 457 ? ? -93.97 -68.05 2 1 TRP A 528 ? ? -67.53 91.06 3 1 MET A 554 ? ? -170.52 139.22 4 1 SER A 561 ? ? 61.15 90.70 5 2 GLN A 507 ? ? -115.19 -162.46 6 2 MET A 554 ? ? -164.21 116.20 7 2 VAL A 562 ? ? -137.68 -43.68 8 2 ARG A 564 ? ? 69.90 111.36 9 3 SER A 453 ? ? -176.98 -62.72 10 3 SER A 561 ? ? 61.74 105.76 11 3 GLU A 565 ? ? 66.05 104.10 12 3 ASN A 566 ? ? -113.66 56.08 13 4 SER A 453 ? ? -167.89 -57.68 14 4 TRP A 528 ? ? -69.21 95.17 15 4 ASN A 546 ? ? -117.12 -168.15 16 4 ASN A 568 ? ? -147.94 21.88 17 5 ALA A 450 ? ? -69.57 90.97 18 5 GLU A 457 ? ? -94.83 -66.28 19 5 ASP A 475 ? ? -53.39 104.49 20 5 SER A 477 ? ? -68.84 98.36 21 5 LYS A 559 ? ? -56.76 97.15 22 5 SER A 561 ? ? -65.20 99.95 23 5 ARG A 564 ? ? -118.37 -162.19 24 5 ASN A 566 ? ? -171.31 78.17 25 6 SER A 453 ? ? 70.76 -0.72 26 6 GLN A 507 ? ? -105.52 -164.05 27 6 SER A 524 ? ? -90.42 -68.30 28 7 ALA A 450 ? ? -152.02 89.26 29 7 SER A 453 ? ? 177.26 -42.55 30 7 SER A 477 ? ? -66.20 98.01 31 7 GLU A 492 ? ? -115.53 79.84 32 7 LYS A 559 ? ? -59.80 98.96 33 7 ARG A 564 ? ? 67.73 128.76 34 7 ASN A 568 ? ? 59.48 85.10 35 8 ASP A 475 ? ? -59.11 108.70 36 8 SER A 561 ? ? 70.22 -174.66 37 9 GLN A 507 ? ? -107.69 -166.53 38 9 PRO A 523 ? ? -99.90 30.70 39 9 MET A 554 ? ? -169.57 115.97 40 9 GLU A 565 ? ? -160.44 110.28 41 9 GLU A 567 ? ? -162.77 -44.86 42 10 GLU A 457 ? ? -87.68 -76.11 43 10 ARG A 555 ? ? -160.86 108.51 44 10 LYS A 559 ? ? -54.02 105.77 45 10 SER A 560 ? ? -160.65 -41.64 46 10 ASN A 568 ? ? 59.51 83.86 47 11 GLU A 457 ? ? -70.33 -71.38 48 11 SER A 521 ? ? -152.41 79.35 49 11 ASN A 566 ? ? 74.34 -29.39 50 11 ASN A 568 ? ? 74.01 -75.39 51 12 ALA A 450 ? ? -59.44 93.44 52 12 GLU A 567 ? ? 56.73 -80.16 53 13 ALA A 450 ? ? -63.11 86.59 54 13 LYS A 559 ? ? -67.36 96.42 55 13 GLU A 565 ? ? -62.11 97.45 56 13 ASN A 568 ? ? 56.37 83.24 57 14 ALA A 450 ? ? -65.08 89.33 58 14 LYS A 559 ? ? -60.68 94.05 59 14 SER A 560 ? ? -84.57 -72.45 60 14 GLU A 565 ? ? 69.74 65.95 61 15 GLU A 457 ? ? -80.71 -72.16 62 15 ALA A 494 ? ? -161.32 118.06 63 15 LYS A 559 ? ? -69.56 90.53 64 15 SER A 561 ? ? 63.91 107.11 65 15 ASN A 566 ? ? -156.38 31.46 66 15 ASN A 568 ? ? 63.35 95.23 67 16 ALA A 450 ? ? -161.66 90.53 68 16 GLU A 457 ? ? -81.01 -74.19 69 16 SER A 524 ? ? -97.99 -70.88 70 16 TRP A 528 ? ? -69.27 91.74 71 16 SER A 561 ? ? 60.19 98.92 72 16 ARG A 564 ? ? 64.47 -167.04 73 16 GLU A 565 ? ? 73.37 -59.17 74 16 GLU A 567 ? ? -72.64 -78.43 75 16 ASN A 568 ? ? 62.43 142.11 76 17 SER A 453 ? ? -174.68 -52.72 77 17 SER A 561 ? ? 65.23 -175.59 78 18 SER A 477 ? ? -64.28 99.71 79 18 TRP A 528 ? ? -68.57 87.77 80 18 GLU A 567 ? ? -135.62 -87.57 81 18 ASN A 568 ? ? 21.42 76.80 82 19 ALA A 450 ? ? -61.21 94.15 83 19 SER A 451 ? ? -118.39 79.93 84 19 SER A 453 ? ? -179.96 -46.79 85 19 GLU A 491 ? ? -59.96 100.15 86 19 TRP A 528 ? ? -68.57 97.81 87 19 LYS A 559 ? ? -62.42 99.72 88 19 SER A 560 ? ? -169.17 84.88 89 19 MET A 563 ? ? 73.31 124.39 90 19 ASN A 566 ? ? -96.08 40.47 91 20 MET A 563 ? ? 63.22 -170.06 # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Northeast Structural Genomics Consortium' 1 NESG PSI:Biology 'Structural Genomics Consortium' 2 SGC ? 'Chaperone-Enabled Studies of Epigenetic Regulation Enzymes' 3 CEBS PSI:Biology # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LLL _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LLL _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents ;0.5 mM [U-13C; U-15N] protein, 10 mM sodium phosphate, 450 mM sodium chloride, 10 uM ZnSO4, 10 mM DTT, 0.01 % NaN3, 1 mM benzamidine, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 0.5 ? mM '[U-13C; U-15N]' 1 'sodium phosphate-2' 10 ? mM ? 1 'sodium chloride-3' 450 ? mM ? 1 ZnSO4-4 10 ? uM ? 1 DTT-5 10 ? mM ? 1 NaN3-6 0.01 ? % ? 1 benzamidine-7 1 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 450 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCO' 1 2 1 '3D HNCA' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HBHA(CO)NH' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY aliphatic' 1 9 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_refine.entry_id 2LLL _pdbx_nmr_refine.method 'restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 Goddard 'peak picking' Sparky ? 2 'Lemak,Steren,Llinas, Arrowsmith' 'chemical shift assignment' FMC ? 3 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 4 'Bhattacharya and Montelione' validation PSVS ? 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 6 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 7 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 431 ? A MET 1 2 1 Y 1 A HIS 432 ? A HIS 2 3 1 Y 1 A HIS 433 ? A HIS 3 4 1 Y 1 A HIS 434 ? A HIS 4 5 1 Y 1 A HIS 435 ? A HIS 5 6 1 Y 1 A HIS 436 ? A HIS 6 7 1 Y 1 A HIS 437 ? A HIS 7 8 1 Y 1 A SER 438 ? A SER 8 9 1 Y 1 A SER 439 ? A SER 9 10 1 Y 1 A GLY 440 ? A GLY 10 11 1 Y 1 A ARG 441 ? A ARG 11 12 1 Y 1 A GLU 442 ? A GLU 12 13 1 Y 1 A ASN 443 ? A ASN 13 14 1 Y 1 A LEU 444 ? A LEU 14 15 1 Y 1 A TYR 445 ? A TYR 15 16 1 Y 1 A PHE 446 ? A PHE 16 17 1 Y 1 A GLN 447 ? A GLN 17 18 1 Y 1 A GLY 448 ? A GLY 18 19 2 Y 1 A MET 431 ? A MET 1 20 2 Y 1 A HIS 432 ? A HIS 2 21 2 Y 1 A HIS 433 ? A HIS 3 22 2 Y 1 A HIS 434 ? A HIS 4 23 2 Y 1 A HIS 435 ? A HIS 5 24 2 Y 1 A HIS 436 ? A HIS 6 25 2 Y 1 A HIS 437 ? A HIS 7 26 2 Y 1 A SER 438 ? A SER 8 27 2 Y 1 A SER 439 ? A SER 9 28 2 Y 1 A GLY 440 ? A GLY 10 29 2 Y 1 A ARG 441 ? A ARG 11 30 2 Y 1 A GLU 442 ? A GLU 12 31 2 Y 1 A ASN 443 ? A ASN 13 32 2 Y 1 A LEU 444 ? A LEU 14 33 2 Y 1 A TYR 445 ? A TYR 15 34 2 Y 1 A PHE 446 ? A PHE 16 35 2 Y 1 A GLN 447 ? A GLN 17 36 2 Y 1 A GLY 448 ? A GLY 18 37 3 Y 1 A MET 431 ? A MET 1 38 3 Y 1 A HIS 432 ? A HIS 2 39 3 Y 1 A HIS 433 ? A HIS 3 40 3 Y 1 A HIS 434 ? A HIS 4 41 3 Y 1 A HIS 435 ? A HIS 5 42 3 Y 1 A HIS 436 ? A HIS 6 43 3 Y 1 A HIS 437 ? A HIS 7 44 3 Y 1 A SER 438 ? A SER 8 45 3 Y 1 A SER 439 ? A SER 9 46 3 Y 1 A GLY 440 ? A GLY 10 47 3 Y 1 A ARG 441 ? A ARG 11 48 3 Y 1 A GLU 442 ? A GLU 12 49 3 Y 1 A ASN 443 ? A ASN 13 50 3 Y 1 A LEU 444 ? A LEU 14 51 3 Y 1 A TYR 445 ? A TYR 15 52 3 Y 1 A PHE 446 ? A PHE 16 53 3 Y 1 A GLN 447 ? A GLN 17 54 3 Y 1 A GLY 448 ? A GLY 18 55 4 Y 1 A MET 431 ? A MET 1 56 4 Y 1 A HIS 432 ? A HIS 2 57 4 Y 1 A HIS 433 ? A HIS 3 58 4 Y 1 A HIS 434 ? A HIS 4 59 4 Y 1 A HIS 435 ? A HIS 5 60 4 Y 1 A HIS 436 ? A HIS 6 61 4 Y 1 A HIS 437 ? A HIS 7 62 4 Y 1 A SER 438 ? A SER 8 63 4 Y 1 A SER 439 ? A SER 9 64 4 Y 1 A GLY 440 ? A GLY 10 65 4 Y 1 A ARG 441 ? A ARG 11 66 4 Y 1 A GLU 442 ? A GLU 12 67 4 Y 1 A ASN 443 ? A ASN 13 68 4 Y 1 A LEU 444 ? A LEU 14 69 4 Y 1 A TYR 445 ? A TYR 15 70 4 Y 1 A PHE 446 ? A PHE 16 71 4 Y 1 A GLN 447 ? A GLN 17 72 4 Y 1 A GLY 448 ? A GLY 18 73 5 Y 1 A MET 431 ? A MET 1 74 5 Y 1 A HIS 432 ? A HIS 2 75 5 Y 1 A HIS 433 ? A HIS 3 76 5 Y 1 A HIS 434 ? A HIS 4 77 5 Y 1 A HIS 435 ? A HIS 5 78 5 Y 1 A HIS 436 ? A HIS 6 79 5 Y 1 A HIS 437 ? A HIS 7 80 5 Y 1 A SER 438 ? A SER 8 81 5 Y 1 A SER 439 ? A SER 9 82 5 Y 1 A GLY 440 ? A GLY 10 83 5 Y 1 A ARG 441 ? A ARG 11 84 5 Y 1 A GLU 442 ? A GLU 12 85 5 Y 1 A ASN 443 ? A ASN 13 86 5 Y 1 A LEU 444 ? A LEU 14 87 5 Y 1 A TYR 445 ? A TYR 15 88 5 Y 1 A PHE 446 ? A PHE 16 89 5 Y 1 A GLN 447 ? A GLN 17 90 5 Y 1 A GLY 448 ? A GLY 18 91 6 Y 1 A MET 431 ? A MET 1 92 6 Y 1 A HIS 432 ? A HIS 2 93 6 Y 1 A HIS 433 ? A HIS 3 94 6 Y 1 A HIS 434 ? A HIS 4 95 6 Y 1 A HIS 435 ? A HIS 5 96 6 Y 1 A HIS 436 ? A HIS 6 97 6 Y 1 A HIS 437 ? A HIS 7 98 6 Y 1 A SER 438 ? A SER 8 99 6 Y 1 A SER 439 ? A SER 9 100 6 Y 1 A GLY 440 ? A GLY 10 101 6 Y 1 A ARG 441 ? A ARG 11 102 6 Y 1 A GLU 442 ? A GLU 12 103 6 Y 1 A ASN 443 ? A ASN 13 104 6 Y 1 A LEU 444 ? A LEU 14 105 6 Y 1 A TYR 445 ? A TYR 15 106 6 Y 1 A PHE 446 ? A PHE 16 107 6 Y 1 A GLN 447 ? A GLN 17 108 6 Y 1 A GLY 448 ? A GLY 18 109 7 Y 1 A MET 431 ? A MET 1 110 7 Y 1 A HIS 432 ? A HIS 2 111 7 Y 1 A HIS 433 ? A HIS 3 112 7 Y 1 A HIS 434 ? A HIS 4 113 7 Y 1 A HIS 435 ? A HIS 5 114 7 Y 1 A HIS 436 ? A HIS 6 115 7 Y 1 A HIS 437 ? A HIS 7 116 7 Y 1 A SER 438 ? A SER 8 117 7 Y 1 A SER 439 ? A SER 9 118 7 Y 1 A GLY 440 ? A GLY 10 119 7 Y 1 A ARG 441 ? A ARG 11 120 7 Y 1 A GLU 442 ? A GLU 12 121 7 Y 1 A ASN 443 ? A ASN 13 122 7 Y 1 A LEU 444 ? A LEU 14 123 7 Y 1 A TYR 445 ? A TYR 15 124 7 Y 1 A PHE 446 ? A PHE 16 125 7 Y 1 A GLN 447 ? A GLN 17 126 7 Y 1 A GLY 448 ? A GLY 18 127 8 Y 1 A MET 431 ? A MET 1 128 8 Y 1 A HIS 432 ? A HIS 2 129 8 Y 1 A HIS 433 ? A HIS 3 130 8 Y 1 A HIS 434 ? A HIS 4 131 8 Y 1 A HIS 435 ? A HIS 5 132 8 Y 1 A HIS 436 ? A HIS 6 133 8 Y 1 A HIS 437 ? A HIS 7 134 8 Y 1 A SER 438 ? A SER 8 135 8 Y 1 A SER 439 ? A SER 9 136 8 Y 1 A GLY 440 ? A GLY 10 137 8 Y 1 A ARG 441 ? A ARG 11 138 8 Y 1 A GLU 442 ? A GLU 12 139 8 Y 1 A ASN 443 ? A ASN 13 140 8 Y 1 A LEU 444 ? A LEU 14 141 8 Y 1 A TYR 445 ? A TYR 15 142 8 Y 1 A PHE 446 ? A PHE 16 143 8 Y 1 A GLN 447 ? A GLN 17 144 8 Y 1 A GLY 448 ? A GLY 18 145 9 Y 1 A MET 431 ? A MET 1 146 9 Y 1 A HIS 432 ? A HIS 2 147 9 Y 1 A HIS 433 ? A HIS 3 148 9 Y 1 A HIS 434 ? A HIS 4 149 9 Y 1 A HIS 435 ? A HIS 5 150 9 Y 1 A HIS 436 ? A HIS 6 151 9 Y 1 A HIS 437 ? A HIS 7 152 9 Y 1 A SER 438 ? A SER 8 153 9 Y 1 A SER 439 ? A SER 9 154 9 Y 1 A GLY 440 ? A GLY 10 155 9 Y 1 A ARG 441 ? A ARG 11 156 9 Y 1 A GLU 442 ? A GLU 12 157 9 Y 1 A ASN 443 ? A ASN 13 158 9 Y 1 A LEU 444 ? A LEU 14 159 9 Y 1 A TYR 445 ? A TYR 15 160 9 Y 1 A PHE 446 ? A PHE 16 161 9 Y 1 A GLN 447 ? A GLN 17 162 9 Y 1 A GLY 448 ? A GLY 18 163 10 Y 1 A MET 431 ? A MET 1 164 10 Y 1 A HIS 432 ? A HIS 2 165 10 Y 1 A HIS 433 ? A HIS 3 166 10 Y 1 A HIS 434 ? A HIS 4 167 10 Y 1 A HIS 435 ? A HIS 5 168 10 Y 1 A HIS 436 ? A HIS 6 169 10 Y 1 A HIS 437 ? A HIS 7 170 10 Y 1 A SER 438 ? A SER 8 171 10 Y 1 A SER 439 ? A SER 9 172 10 Y 1 A GLY 440 ? A GLY 10 173 10 Y 1 A ARG 441 ? A ARG 11 174 10 Y 1 A GLU 442 ? A GLU 12 175 10 Y 1 A ASN 443 ? A ASN 13 176 10 Y 1 A LEU 444 ? A LEU 14 177 10 Y 1 A TYR 445 ? A TYR 15 178 10 Y 1 A PHE 446 ? A PHE 16 179 10 Y 1 A GLN 447 ? A GLN 17 180 10 Y 1 A GLY 448 ? A GLY 18 181 11 Y 1 A MET 431 ? A MET 1 182 11 Y 1 A HIS 432 ? A HIS 2 183 11 Y 1 A HIS 433 ? A HIS 3 184 11 Y 1 A HIS 434 ? A HIS 4 185 11 Y 1 A HIS 435 ? A HIS 5 186 11 Y 1 A HIS 436 ? A HIS 6 187 11 Y 1 A HIS 437 ? A HIS 7 188 11 Y 1 A SER 438 ? A SER 8 189 11 Y 1 A SER 439 ? A SER 9 190 11 Y 1 A GLY 440 ? A GLY 10 191 11 Y 1 A ARG 441 ? A ARG 11 192 11 Y 1 A GLU 442 ? A GLU 12 193 11 Y 1 A ASN 443 ? A ASN 13 194 11 Y 1 A LEU 444 ? A LEU 14 195 11 Y 1 A TYR 445 ? A TYR 15 196 11 Y 1 A PHE 446 ? A PHE 16 197 11 Y 1 A GLN 447 ? A GLN 17 198 11 Y 1 A GLY 448 ? A GLY 18 199 12 Y 1 A MET 431 ? A MET 1 200 12 Y 1 A HIS 432 ? A HIS 2 201 12 Y 1 A HIS 433 ? A HIS 3 202 12 Y 1 A HIS 434 ? A HIS 4 203 12 Y 1 A HIS 435 ? A HIS 5 204 12 Y 1 A HIS 436 ? A HIS 6 205 12 Y 1 A HIS 437 ? A HIS 7 206 12 Y 1 A SER 438 ? A SER 8 207 12 Y 1 A SER 439 ? A SER 9 208 12 Y 1 A GLY 440 ? A GLY 10 209 12 Y 1 A ARG 441 ? A ARG 11 210 12 Y 1 A GLU 442 ? A GLU 12 211 12 Y 1 A ASN 443 ? A ASN 13 212 12 Y 1 A LEU 444 ? A LEU 14 213 12 Y 1 A TYR 445 ? A TYR 15 214 12 Y 1 A PHE 446 ? A PHE 16 215 12 Y 1 A GLN 447 ? A GLN 17 216 12 Y 1 A GLY 448 ? A GLY 18 217 13 Y 1 A MET 431 ? A MET 1 218 13 Y 1 A HIS 432 ? A HIS 2 219 13 Y 1 A HIS 433 ? A HIS 3 220 13 Y 1 A HIS 434 ? A HIS 4 221 13 Y 1 A HIS 435 ? A HIS 5 222 13 Y 1 A HIS 436 ? A HIS 6 223 13 Y 1 A HIS 437 ? A HIS 7 224 13 Y 1 A SER 438 ? A SER 8 225 13 Y 1 A SER 439 ? A SER 9 226 13 Y 1 A GLY 440 ? A GLY 10 227 13 Y 1 A ARG 441 ? A ARG 11 228 13 Y 1 A GLU 442 ? A GLU 12 229 13 Y 1 A ASN 443 ? A ASN 13 230 13 Y 1 A LEU 444 ? A LEU 14 231 13 Y 1 A TYR 445 ? A TYR 15 232 13 Y 1 A PHE 446 ? A PHE 16 233 13 Y 1 A GLN 447 ? A GLN 17 234 13 Y 1 A GLY 448 ? A GLY 18 235 14 Y 1 A MET 431 ? A MET 1 236 14 Y 1 A HIS 432 ? A HIS 2 237 14 Y 1 A HIS 433 ? A HIS 3 238 14 Y 1 A HIS 434 ? A HIS 4 239 14 Y 1 A HIS 435 ? A HIS 5 240 14 Y 1 A HIS 436 ? A HIS 6 241 14 Y 1 A HIS 437 ? A HIS 7 242 14 Y 1 A SER 438 ? A SER 8 243 14 Y 1 A SER 439 ? A SER 9 244 14 Y 1 A GLY 440 ? A GLY 10 245 14 Y 1 A ARG 441 ? A ARG 11 246 14 Y 1 A GLU 442 ? A GLU 12 247 14 Y 1 A ASN 443 ? A ASN 13 248 14 Y 1 A LEU 444 ? A LEU 14 249 14 Y 1 A TYR 445 ? A TYR 15 250 14 Y 1 A PHE 446 ? A PHE 16 251 14 Y 1 A GLN 447 ? A GLN 17 252 14 Y 1 A GLY 448 ? A GLY 18 253 15 Y 1 A MET 431 ? A MET 1 254 15 Y 1 A HIS 432 ? A HIS 2 255 15 Y 1 A HIS 433 ? A HIS 3 256 15 Y 1 A HIS 434 ? A HIS 4 257 15 Y 1 A HIS 435 ? A HIS 5 258 15 Y 1 A HIS 436 ? A HIS 6 259 15 Y 1 A HIS 437 ? A HIS 7 260 15 Y 1 A SER 438 ? A SER 8 261 15 Y 1 A SER 439 ? A SER 9 262 15 Y 1 A GLY 440 ? A GLY 10 263 15 Y 1 A ARG 441 ? A ARG 11 264 15 Y 1 A GLU 442 ? A GLU 12 265 15 Y 1 A ASN 443 ? A ASN 13 266 15 Y 1 A LEU 444 ? A LEU 14 267 15 Y 1 A TYR 445 ? A TYR 15 268 15 Y 1 A PHE 446 ? A PHE 16 269 15 Y 1 A GLN 447 ? A GLN 17 270 15 Y 1 A GLY 448 ? A GLY 18 271 16 Y 1 A MET 431 ? A MET 1 272 16 Y 1 A HIS 432 ? A HIS 2 273 16 Y 1 A HIS 433 ? A HIS 3 274 16 Y 1 A HIS 434 ? A HIS 4 275 16 Y 1 A HIS 435 ? A HIS 5 276 16 Y 1 A HIS 436 ? A HIS 6 277 16 Y 1 A HIS 437 ? A HIS 7 278 16 Y 1 A SER 438 ? A SER 8 279 16 Y 1 A SER 439 ? A SER 9 280 16 Y 1 A GLY 440 ? A GLY 10 281 16 Y 1 A ARG 441 ? A ARG 11 282 16 Y 1 A GLU 442 ? A GLU 12 283 16 Y 1 A ASN 443 ? A ASN 13 284 16 Y 1 A LEU 444 ? A LEU 14 285 16 Y 1 A TYR 445 ? A TYR 15 286 16 Y 1 A PHE 446 ? A PHE 16 287 16 Y 1 A GLN 447 ? A GLN 17 288 16 Y 1 A GLY 448 ? A GLY 18 289 17 Y 1 A MET 431 ? A MET 1 290 17 Y 1 A HIS 432 ? A HIS 2 291 17 Y 1 A HIS 433 ? A HIS 3 292 17 Y 1 A HIS 434 ? A HIS 4 293 17 Y 1 A HIS 435 ? A HIS 5 294 17 Y 1 A HIS 436 ? A HIS 6 295 17 Y 1 A HIS 437 ? A HIS 7 296 17 Y 1 A SER 438 ? A SER 8 297 17 Y 1 A SER 439 ? A SER 9 298 17 Y 1 A GLY 440 ? A GLY 10 299 17 Y 1 A ARG 441 ? A ARG 11 300 17 Y 1 A GLU 442 ? A GLU 12 301 17 Y 1 A ASN 443 ? A ASN 13 302 17 Y 1 A LEU 444 ? A LEU 14 303 17 Y 1 A TYR 445 ? A TYR 15 304 17 Y 1 A PHE 446 ? A PHE 16 305 17 Y 1 A GLN 447 ? A GLN 17 306 17 Y 1 A GLY 448 ? A GLY 18 307 18 Y 1 A MET 431 ? A MET 1 308 18 Y 1 A HIS 432 ? A HIS 2 309 18 Y 1 A HIS 433 ? A HIS 3 310 18 Y 1 A HIS 434 ? A HIS 4 311 18 Y 1 A HIS 435 ? A HIS 5 312 18 Y 1 A HIS 436 ? A HIS 6 313 18 Y 1 A HIS 437 ? A HIS 7 314 18 Y 1 A SER 438 ? A SER 8 315 18 Y 1 A SER 439 ? A SER 9 316 18 Y 1 A GLY 440 ? A GLY 10 317 18 Y 1 A ARG 441 ? A ARG 11 318 18 Y 1 A GLU 442 ? A GLU 12 319 18 Y 1 A ASN 443 ? A ASN 13 320 18 Y 1 A LEU 444 ? A LEU 14 321 18 Y 1 A TYR 445 ? A TYR 15 322 18 Y 1 A PHE 446 ? A PHE 16 323 18 Y 1 A GLN 447 ? A GLN 17 324 18 Y 1 A GLY 448 ? A GLY 18 325 19 Y 1 A MET 431 ? A MET 1 326 19 Y 1 A HIS 432 ? A HIS 2 327 19 Y 1 A HIS 433 ? A HIS 3 328 19 Y 1 A HIS 434 ? A HIS 4 329 19 Y 1 A HIS 435 ? A HIS 5 330 19 Y 1 A HIS 436 ? A HIS 6 331 19 Y 1 A HIS 437 ? A HIS 7 332 19 Y 1 A SER 438 ? A SER 8 333 19 Y 1 A SER 439 ? A SER 9 334 19 Y 1 A GLY 440 ? A GLY 10 335 19 Y 1 A ARG 441 ? A ARG 11 336 19 Y 1 A GLU 442 ? A GLU 12 337 19 Y 1 A ASN 443 ? A ASN 13 338 19 Y 1 A LEU 444 ? A LEU 14 339 19 Y 1 A TYR 445 ? A TYR 15 340 19 Y 1 A PHE 446 ? A PHE 16 341 19 Y 1 A GLN 447 ? A GLN 17 342 19 Y 1 A GLY 448 ? A GLY 18 343 20 Y 1 A MET 431 ? A MET 1 344 20 Y 1 A HIS 432 ? A HIS 2 345 20 Y 1 A HIS 433 ? A HIS 3 346 20 Y 1 A HIS 434 ? A HIS 4 347 20 Y 1 A HIS 435 ? A HIS 5 348 20 Y 1 A HIS 436 ? A HIS 6 349 20 Y 1 A HIS 437 ? A HIS 7 350 20 Y 1 A SER 438 ? A SER 8 351 20 Y 1 A SER 439 ? A SER 9 352 20 Y 1 A GLY 440 ? A GLY 10 353 20 Y 1 A ARG 441 ? A ARG 11 354 20 Y 1 A GLU 442 ? A GLU 12 355 20 Y 1 A ASN 443 ? A ASN 13 356 20 Y 1 A LEU 444 ? A LEU 14 357 20 Y 1 A TYR 445 ? A TYR 15 358 20 Y 1 A PHE 446 ? A PHE 16 359 20 Y 1 A GLN 447 ? A GLN 17 360 20 Y 1 A GLY 448 ? A GLY 18 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2LLL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #