data_2LLX # _entry.id 2LLX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LLX pdb_00002llx 10.2210/pdb2llx/pdb RCSB RCSB102543 ? ? BMRB 18092 ? 10.13018/BMR18092 WWPDB D_1000102543 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-05-30 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' 7 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LLX _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-11-18 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 6116 BMRB 'Backbone (H,CA,CB and N) resonance assignment of the N-terminal domain of human eRF1' unspecified 1DT9 PDB 'Crystal structure of human eukaryotic release factor eRF1' unspecified 3E1Y PDB 'Crystal structure of human eRF1/eRF3 complex' unspecified 6763 BMRB 'NMR assignments of the middle domain of human polypeptide release factor eRF1' unspecified 2HST PDB 'NMR structure and dynamics of the middle domain of human eRF1' unspecified 15366 BMRB ;NMR assignments of the C-terminal domain of human polypeptide release factor eRF1 ; unspecified 2KTV PDB 'NMR solution structure of the open conformer of the C-domain of human eRF1' unspecified 2KTU PDB 'NMR solution structure of the closed conformer of the C-domain of human eRF1' unspecified 18092 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Polshakov, V.I.' 1 'Eliseev, B.D.' 2 'Birdsall, B.' 3 'Frolova, L.Y.' 4 # _citation.id primary _citation.title 'Structure and dynamics in solution of the stop codon decoding N-terminal domain of the human polypeptide chain release factor eRF1.' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 21 _citation.page_first 896 _citation.page_last 903 _citation.year 2012 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22517631 _citation.pdbx_database_id_DOI 10.1002/pro.2067 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Polshakov, V.I.' 1 ? primary 'Eliseev, B.D.' 2 ? primary 'Birdsall, B.' 3 ? primary 'Frolova, L.Y.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Eukaryotic peptide chain release factor subunit 1' _entity.formula_weight 16769.348 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 1-142' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Eukaryotic release factor 1, eRF1, Protein Cl1, TB3-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQ RLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALLSDLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQ RLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALLSDLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ASP n 1 4 ASP n 1 5 PRO n 1 6 SER n 1 7 ALA n 1 8 ALA n 1 9 ASP n 1 10 ARG n 1 11 ASN n 1 12 VAL n 1 13 GLU n 1 14 ILE n 1 15 TRP n 1 16 LYS n 1 17 ILE n 1 18 LYS n 1 19 LYS n 1 20 LEU n 1 21 ILE n 1 22 LYS n 1 23 SER n 1 24 LEU n 1 25 GLU n 1 26 ALA n 1 27 ALA n 1 28 ARG n 1 29 GLY n 1 30 ASN n 1 31 GLY n 1 32 THR n 1 33 SER n 1 34 MET n 1 35 ILE n 1 36 SER n 1 37 LEU n 1 38 ILE n 1 39 ILE n 1 40 PRO n 1 41 PRO n 1 42 LYS n 1 43 ASP n 1 44 GLN n 1 45 ILE n 1 46 SER n 1 47 ARG n 1 48 VAL n 1 49 ALA n 1 50 LYS n 1 51 MET n 1 52 LEU n 1 53 ALA n 1 54 ASP n 1 55 GLU n 1 56 PHE n 1 57 GLY n 1 58 THR n 1 59 ALA n 1 60 SER n 1 61 ASN n 1 62 ILE n 1 63 LYS n 1 64 SER n 1 65 ARG n 1 66 VAL n 1 67 ASN n 1 68 ARG n 1 69 LEU n 1 70 SER n 1 71 VAL n 1 72 LEU n 1 73 GLY n 1 74 ALA n 1 75 ILE n 1 76 THR n 1 77 SER n 1 78 VAL n 1 79 GLN n 1 80 GLN n 1 81 ARG n 1 82 LEU n 1 83 LYS n 1 84 LEU n 1 85 TYR n 1 86 ASN n 1 87 LYS n 1 88 VAL n 1 89 PRO n 1 90 PRO n 1 91 ASN n 1 92 GLY n 1 93 LEU n 1 94 VAL n 1 95 VAL n 1 96 TYR n 1 97 CYS n 1 98 GLY n 1 99 THR n 1 100 ILE n 1 101 VAL n 1 102 THR n 1 103 GLU n 1 104 GLU n 1 105 GLY n 1 106 LYS n 1 107 GLU n 1 108 LYS n 1 109 LYS n 1 110 VAL n 1 111 ASN n 1 112 ILE n 1 113 ASP n 1 114 PHE n 1 115 GLU n 1 116 PRO n 1 117 PHE n 1 118 LYS n 1 119 PRO n 1 120 ILE n 1 121 ASN n 1 122 THR n 1 123 SER n 1 124 LEU n 1 125 TYR n 1 126 LEU n 1 127 CYS n 1 128 ASP n 1 129 ASN n 1 130 LYS n 1 131 PHE n 1 132 HIS n 1 133 THR n 1 134 GLU n 1 135 ALA n 1 136 LEU n 1 137 THR n 1 138 ALA n 1 139 LEU n 1 140 LEU n 1 141 SER n 1 142 ASP n 1 143 LEU n 1 144 GLU n 1 145 HIS n 1 146 HIS n 1 147 HIS n 1 148 HIS n 1 149 HIS n 1 150 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ETF1, ERF1, RF1, SUP45L1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant pUBS _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET23b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 CYS 127 127 127 CYS CYS A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 HIS 132 132 132 HIS HIS A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 LEU 143 143 ? ? ? A . n A 1 144 GLU 144 144 ? ? ? A . n A 1 145 HIS 145 145 ? ? ? A . n A 1 146 HIS 146 146 ? ? ? A . n A 1 147 HIS 147 147 ? ? ? A . n A 1 148 HIS 148 148 ? ? ? A . n A 1 149 HIS 149 149 ? ? ? A . n A 1 150 HIS 150 150 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LLX _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LLX _struct.title 'Solution structure of the N-terminal domain of human polypeptide chain release factor eRF1' _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LLX _struct_keywords.pdbx_keywords TRANSLATION _struct_keywords.text 'protein synthesis termination, stop codon recognition, TRANSLATION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ERF1_HUMAN _struct_ref.pdbx_db_accession P62495 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQ RLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALLSD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LLX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 142 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62495 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 142 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 142 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LLX LEU A 143 ? UNP P62495 ? ? 'expression tag' 143 1 1 2LLX GLU A 144 ? UNP P62495 ? ? 'expression tag' 144 2 1 2LLX HIS A 145 ? UNP P62495 ? ? 'expression tag' 145 3 1 2LLX HIS A 146 ? UNP P62495 ? ? 'expression tag' 146 4 1 2LLX HIS A 147 ? UNP P62495 ? ? 'expression tag' 147 5 1 2LLX HIS A 148 ? UNP P62495 ? ? 'expression tag' 148 6 1 2LLX HIS A 149 ? UNP P62495 ? ? 'expression tag' 149 7 1 2LLX HIS A 150 ? UNP P62495 ? ? 'expression tag' 150 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 8 ? ALA A 26 ? ALA A 8 ALA A 26 1 ? 19 HELX_P HELX_P2 2 GLN A 44 ? SER A 60 ? GLN A 44 SER A 60 1 ? 17 HELX_P HELX_P3 3 SER A 64 ? LYS A 83 ? SER A 64 LYS A 83 1 ? 20 HELX_P HELX_P4 4 THR A 133 ? ASP A 142 ? THR A 133 ASP A 142 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 107 ? PHE A 114 ? GLU A 107 PHE A 114 A 2 LEU A 93 ? VAL A 101 ? LEU A 93 VAL A 101 A 3 MET A 34 ? ILE A 39 ? MET A 34 ILE A 39 A 4 LEU A 124 ? ASP A 128 ? LEU A 124 ASP A 128 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 110 ? O VAL A 110 N GLY A 98 ? N GLY A 98 A 2 3 O LEU A 93 ? O LEU A 93 N ILE A 39 ? N ILE A 39 A 3 4 N SER A 36 ? N SER A 36 O LEU A 126 ? O LEU A 126 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 15 _pdbx_validate_close_contact.auth_atom_id_1 H _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ILE _pdbx_validate_close_contact.auth_seq_id_1 39 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LEU _pdbx_validate_close_contact.auth_seq_id_2 93 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? 170.89 77.22 2 1 ALA A 7 ? ? -76.18 -87.28 3 1 THR A 32 ? ? 166.11 77.40 4 1 PRO A 89 ? ? -47.13 164.91 5 1 ASN A 121 ? ? -89.69 43.62 6 2 PRO A 5 ? ? -68.12 -87.75 7 2 SER A 6 ? ? 174.12 136.27 8 2 PRO A 89 ? ? -47.46 164.94 9 2 ASN A 121 ? ? -89.02 46.53 10 2 ASP A 128 ? ? -160.95 -161.86 11 3 PRO A 5 ? ? -40.05 -81.61 12 3 ALA A 7 ? ? -108.55 -68.99 13 3 PRO A 89 ? ? -47.61 164.96 14 3 ASN A 121 ? ? -89.33 44.98 15 4 SER A 6 ? ? 165.94 80.48 16 4 ALA A 7 ? ? -68.69 -87.16 17 4 PRO A 89 ? ? -45.38 164.82 18 4 ASN A 121 ? ? -88.51 48.05 19 5 SER A 6 ? ? 173.85 76.40 20 5 ALA A 7 ? ? -77.56 -86.14 21 5 THR A 32 ? ? 71.70 65.01 22 5 PRO A 89 ? ? -47.61 165.00 23 5 ASN A 121 ? ? -86.72 49.47 24 6 PRO A 5 ? ? -65.62 -90.40 25 6 THR A 32 ? ? 75.54 76.16 26 6 PRO A 89 ? ? -47.06 164.94 27 6 ASN A 121 ? ? -90.87 44.88 28 7 PRO A 5 ? ? -53.33 -90.84 29 7 ALA A 7 ? ? -77.39 -83.88 30 7 PRO A 89 ? ? -44.40 161.07 31 8 SER A 6 ? ? -178.60 37.01 32 8 ALA A 7 ? ? -53.85 -81.97 33 8 THR A 32 ? ? 73.44 68.24 34 8 PRO A 89 ? ? -43.96 164.89 35 8 ASN A 121 ? ? -88.23 45.38 36 8 ASP A 128 ? ? -164.87 -168.68 37 8 THR A 133 ? ? -93.77 37.42 38 9 PRO A 5 ? ? -49.14 -85.28 39 9 ALA A 7 ? ? -99.20 -82.55 40 9 THR A 32 ? ? 74.16 69.39 41 9 PRO A 89 ? ? -46.16 164.96 42 9 ASN A 121 ? ? -86.73 47.46 43 9 THR A 133 ? ? -91.69 49.32 44 10 PRO A 5 ? ? -80.77 -77.70 45 10 PRO A 89 ? ? -45.44 164.79 46 10 ASN A 121 ? ? -87.27 46.11 47 11 SER A 6 ? ? 172.91 75.16 48 11 ALA A 7 ? ? -74.02 -85.60 49 11 PRO A 89 ? ? -41.79 163.80 50 11 ASN A 121 ? ? -91.61 44.02 51 12 PRO A 5 ? ? -62.45 -151.21 52 12 THR A 32 ? ? 69.37 61.05 53 12 PRO A 89 ? ? -46.57 164.92 54 12 ASN A 121 ? ? -90.33 44.55 55 13 PRO A 5 ? ? -52.79 -84.11 56 13 ALA A 7 ? ? -90.35 -80.25 57 13 PRO A 89 ? ? -46.79 165.03 58 13 THR A 133 ? ? -95.68 40.04 59 14 PRO A 5 ? ? -53.59 -78.84 60 14 SER A 6 ? ? -163.84 30.52 61 14 ALA A 7 ? ? -52.64 -87.22 62 14 THR A 32 ? ? 74.69 70.37 63 14 PRO A 89 ? ? -45.82 164.91 64 14 ASN A 121 ? ? -86.50 46.16 65 15 PRO A 89 ? ? -44.45 165.01 66 15 ASN A 121 ? ? -89.18 49.48 67 15 ASP A 128 ? ? -162.05 -160.56 68 16 PRO A 89 ? ? -43.31 164.91 69 16 ASN A 121 ? ? -90.11 46.20 70 17 PRO A 5 ? ? -55.18 -74.63 71 17 THR A 32 ? ? 72.72 71.55 72 17 PRO A 89 ? ? -44.90 164.98 73 17 ASN A 121 ? ? -87.67 46.23 74 18 PRO A 5 ? ? -67.29 -95.76 75 18 THR A 32 ? ? 69.65 63.26 76 18 PRO A 89 ? ? -48.02 164.94 77 18 ASN A 121 ? ? -89.06 45.71 78 18 THR A 133 ? ? -93.94 45.11 79 19 PRO A 5 ? ? -56.06 -143.55 80 19 ALA A 7 ? ? -75.87 -82.93 81 19 THR A 32 ? ? 75.29 70.81 82 19 PRO A 89 ? ? -46.67 164.99 83 19 THR A 133 ? ? -94.29 44.51 84 20 PRO A 5 ? ? -48.59 -108.05 85 20 PRO A 89 ? ? -45.10 164.79 86 20 ASN A 121 ? ? -90.29 44.14 87 20 ASP A 128 ? ? -160.59 -158.05 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LLX _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.00 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 2 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.0059 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.0005 _pdbx_nmr_ensemble_rms.entry_id 2LLX _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LLX _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1 mM [U-99% 13C; U-99% 15N] NeRF1, 25 mM sodium chloride, 10 mM sodium phosphate, 2 mM beta-mercaptoethanol, 0.01 % sodium azide, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;1 mM [U-99% 13C; U-99% 15N] NeRF1, 25 mM sodium chloride, 10 mM sodium phosphate, 2 mM beta-mercaptoethanol, 0.01 % sodium azide, 100% D2O ; 2 '100% D2O' '1 mM NeRF1, 25 mM sodium chloride, 10 mM sodium phosphate, 2 mM beta-mercaptoethanol, 0.01 % sodium azide, 100% D2O' 3 '100% D2O' ;1 mM [U-99% 15N] NeRF1, 25 mM sodium chloride, 10 mM sodium phosphate, 2 mM beta-mercaptoethanol, 0.01 % sodium azide, 90% H2O/10% D2O ; 4 '90% H2O/10% D2O' ;1 mM [U-99% 15N] NeRF1, 25 mM sodium chloride, 10 mM sodium phosphate, 2 mM beta-mercaptoethanol, 0.01 % sodium azide, 5.00 % C12E5, 1.068 % hexanol, 90% H2O/10% D2O ; 5 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id NeRF1-1 1 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium chloride-2' 25 ? mM ? 1 'sodium phosphate-3' 10 ? mM ? 1 beta-mercaptoethanol-4 2 ? mM ? 1 'sodium azide-5' 0.01 ? % ? 1 NeRF1-6 1 ? mM '[U-99% 13C; U-99% 15N]' 2 'sodium chloride-7' 25 ? mM ? 2 'sodium phosphate-8' 10 ? mM ? 2 beta-mercaptoethanol-9 2 ? mM ? 2 'sodium azide-10' 0.01 ? % ? 2 NeRF1-11 1 ? mM ? 3 'sodium chloride-12' 25 ? mM ? 3 'sodium phosphate-13' 10 ? mM ? 3 beta-mercaptoethanol-14 2 ? mM ? 3 'sodium azide-15' 0.01 ? % ? 3 NeRF1-16 1 ? mM '[U-99% 15N]' 4 'sodium chloride-17' 25 ? mM ? 4 'sodium phosphate-18' 10 ? mM ? 4 beta-mercaptoethanol-19 2 ? mM ? 4 'sodium azide-20' 0.01 ? % ? 4 NeRF1-21 1 ? mM '[U-99% 15N]' 5 'sodium chloride-22' 25 ? mM ? 5 'sodium phosphate-23' 10 ? mM ? 5 beta-mercaptoethanol-24 2 ? mM ? 5 'sodium azide-25' 0.01 ? % ? 5 C12E5-26 5.00 ? % ? 5 hexanol-27 1.068 ? % ? 5 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.035 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 4 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 3 '2D DQF-COSY' 1 4 3 '2D 1H-1H NOESY' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HNCO' 1 7 1 '3D HNCACB' 1 8 1 '3D HBHA(CO)NH' 1 9 4 '3D HNHA' 1 10 4 '3D HNHB' 1 11 1 '3D H(CCO)NH' 1 12 2 '3D HCCH-TOCSY' 1 13 4 '3D 1H-15N NOESY' 1 14 2 '3D 1H-13C NOESY' 1 15 5 '2D IPAP' 1 16 4 '2D J-modulated 1H-15N HSQC' 1 17 4 '15N{1H} NOE' 1 18 4 '15N T1' 1 19 4 '15N T2' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LLX _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2669 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 975 _pdbx_nmr_constraints.NOE_long_range_total_count 524 _pdbx_nmr_constraints.NOE_medium_range_total_count 494 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 638 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 64 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 126 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 126 # _pdbx_nmr_refine.entry_id 2LLX _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 Varian collection VNMR ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 5.99 3 Goddard 'data analysis' Sparky 3.114 4 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 5 'Polshakov, Feeney' 'data analysis' Anglesearch 2.10 6 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 7 Polshakov 'data analysis' NMRest 0.99 8 Polshakov 'data analysis' RelaxFit 0.99 9 'Laskowski and MacArthur' 'data analysis' ProcheckNMR ? 10 'Accelrys Software Inc.' 'data analysis' 'Insight II' 2000 11 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 12 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 143 ? A LEU 143 2 1 Y 1 A GLU 144 ? A GLU 144 3 1 Y 1 A HIS 145 ? A HIS 145 4 1 Y 1 A HIS 146 ? A HIS 146 5 1 Y 1 A HIS 147 ? A HIS 147 6 1 Y 1 A HIS 148 ? A HIS 148 7 1 Y 1 A HIS 149 ? A HIS 149 8 1 Y 1 A HIS 150 ? A HIS 150 9 2 Y 1 A LEU 143 ? A LEU 143 10 2 Y 1 A GLU 144 ? A GLU 144 11 2 Y 1 A HIS 145 ? A HIS 145 12 2 Y 1 A HIS 146 ? A HIS 146 13 2 Y 1 A HIS 147 ? A HIS 147 14 2 Y 1 A HIS 148 ? A HIS 148 15 2 Y 1 A HIS 149 ? A HIS 149 16 2 Y 1 A HIS 150 ? A HIS 150 17 3 Y 1 A LEU 143 ? A LEU 143 18 3 Y 1 A GLU 144 ? A GLU 144 19 3 Y 1 A HIS 145 ? A HIS 145 20 3 Y 1 A HIS 146 ? A HIS 146 21 3 Y 1 A HIS 147 ? A HIS 147 22 3 Y 1 A HIS 148 ? A HIS 148 23 3 Y 1 A HIS 149 ? A HIS 149 24 3 Y 1 A HIS 150 ? A HIS 150 25 4 Y 1 A LEU 143 ? A LEU 143 26 4 Y 1 A GLU 144 ? A GLU 144 27 4 Y 1 A HIS 145 ? A HIS 145 28 4 Y 1 A HIS 146 ? A HIS 146 29 4 Y 1 A HIS 147 ? A HIS 147 30 4 Y 1 A HIS 148 ? A HIS 148 31 4 Y 1 A HIS 149 ? A HIS 149 32 4 Y 1 A HIS 150 ? A HIS 150 33 5 Y 1 A LEU 143 ? A LEU 143 34 5 Y 1 A GLU 144 ? A GLU 144 35 5 Y 1 A HIS 145 ? A HIS 145 36 5 Y 1 A HIS 146 ? A HIS 146 37 5 Y 1 A HIS 147 ? A HIS 147 38 5 Y 1 A HIS 148 ? A HIS 148 39 5 Y 1 A HIS 149 ? A HIS 149 40 5 Y 1 A HIS 150 ? A HIS 150 41 6 Y 1 A LEU 143 ? A LEU 143 42 6 Y 1 A GLU 144 ? A GLU 144 43 6 Y 1 A HIS 145 ? A HIS 145 44 6 Y 1 A HIS 146 ? A HIS 146 45 6 Y 1 A HIS 147 ? A HIS 147 46 6 Y 1 A HIS 148 ? A HIS 148 47 6 Y 1 A HIS 149 ? A HIS 149 48 6 Y 1 A HIS 150 ? A HIS 150 49 7 Y 1 A LEU 143 ? A LEU 143 50 7 Y 1 A GLU 144 ? A GLU 144 51 7 Y 1 A HIS 145 ? A HIS 145 52 7 Y 1 A HIS 146 ? A HIS 146 53 7 Y 1 A HIS 147 ? A HIS 147 54 7 Y 1 A HIS 148 ? A HIS 148 55 7 Y 1 A HIS 149 ? A HIS 149 56 7 Y 1 A HIS 150 ? A HIS 150 57 8 Y 1 A LEU 143 ? A LEU 143 58 8 Y 1 A GLU 144 ? A GLU 144 59 8 Y 1 A HIS 145 ? A HIS 145 60 8 Y 1 A HIS 146 ? A HIS 146 61 8 Y 1 A HIS 147 ? A HIS 147 62 8 Y 1 A HIS 148 ? A HIS 148 63 8 Y 1 A HIS 149 ? A HIS 149 64 8 Y 1 A HIS 150 ? A HIS 150 65 9 Y 1 A LEU 143 ? A LEU 143 66 9 Y 1 A GLU 144 ? A GLU 144 67 9 Y 1 A HIS 145 ? A HIS 145 68 9 Y 1 A HIS 146 ? A HIS 146 69 9 Y 1 A HIS 147 ? A HIS 147 70 9 Y 1 A HIS 148 ? A HIS 148 71 9 Y 1 A HIS 149 ? A HIS 149 72 9 Y 1 A HIS 150 ? A HIS 150 73 10 Y 1 A LEU 143 ? A LEU 143 74 10 Y 1 A GLU 144 ? A GLU 144 75 10 Y 1 A HIS 145 ? A HIS 145 76 10 Y 1 A HIS 146 ? A HIS 146 77 10 Y 1 A HIS 147 ? A HIS 147 78 10 Y 1 A HIS 148 ? A HIS 148 79 10 Y 1 A HIS 149 ? A HIS 149 80 10 Y 1 A HIS 150 ? A HIS 150 81 11 Y 1 A LEU 143 ? A LEU 143 82 11 Y 1 A GLU 144 ? A GLU 144 83 11 Y 1 A HIS 145 ? A HIS 145 84 11 Y 1 A HIS 146 ? A HIS 146 85 11 Y 1 A HIS 147 ? A HIS 147 86 11 Y 1 A HIS 148 ? A HIS 148 87 11 Y 1 A HIS 149 ? A HIS 149 88 11 Y 1 A HIS 150 ? A HIS 150 89 12 Y 1 A LEU 143 ? A LEU 143 90 12 Y 1 A GLU 144 ? A GLU 144 91 12 Y 1 A HIS 145 ? A HIS 145 92 12 Y 1 A HIS 146 ? A HIS 146 93 12 Y 1 A HIS 147 ? A HIS 147 94 12 Y 1 A HIS 148 ? A HIS 148 95 12 Y 1 A HIS 149 ? A HIS 149 96 12 Y 1 A HIS 150 ? A HIS 150 97 13 Y 1 A LEU 143 ? A LEU 143 98 13 Y 1 A GLU 144 ? A GLU 144 99 13 Y 1 A HIS 145 ? A HIS 145 100 13 Y 1 A HIS 146 ? A HIS 146 101 13 Y 1 A HIS 147 ? A HIS 147 102 13 Y 1 A HIS 148 ? A HIS 148 103 13 Y 1 A HIS 149 ? A HIS 149 104 13 Y 1 A HIS 150 ? A HIS 150 105 14 Y 1 A LEU 143 ? A LEU 143 106 14 Y 1 A GLU 144 ? A GLU 144 107 14 Y 1 A HIS 145 ? A HIS 145 108 14 Y 1 A HIS 146 ? A HIS 146 109 14 Y 1 A HIS 147 ? A HIS 147 110 14 Y 1 A HIS 148 ? A HIS 148 111 14 Y 1 A HIS 149 ? A HIS 149 112 14 Y 1 A HIS 150 ? A HIS 150 113 15 Y 1 A LEU 143 ? A LEU 143 114 15 Y 1 A GLU 144 ? A GLU 144 115 15 Y 1 A HIS 145 ? A HIS 145 116 15 Y 1 A HIS 146 ? A HIS 146 117 15 Y 1 A HIS 147 ? A HIS 147 118 15 Y 1 A HIS 148 ? A HIS 148 119 15 Y 1 A HIS 149 ? A HIS 149 120 15 Y 1 A HIS 150 ? A HIS 150 121 16 Y 1 A LEU 143 ? A LEU 143 122 16 Y 1 A GLU 144 ? A GLU 144 123 16 Y 1 A HIS 145 ? A HIS 145 124 16 Y 1 A HIS 146 ? A HIS 146 125 16 Y 1 A HIS 147 ? A HIS 147 126 16 Y 1 A HIS 148 ? A HIS 148 127 16 Y 1 A HIS 149 ? A HIS 149 128 16 Y 1 A HIS 150 ? A HIS 150 129 17 Y 1 A LEU 143 ? A LEU 143 130 17 Y 1 A GLU 144 ? A GLU 144 131 17 Y 1 A HIS 145 ? A HIS 145 132 17 Y 1 A HIS 146 ? A HIS 146 133 17 Y 1 A HIS 147 ? A HIS 147 134 17 Y 1 A HIS 148 ? A HIS 148 135 17 Y 1 A HIS 149 ? A HIS 149 136 17 Y 1 A HIS 150 ? A HIS 150 137 18 Y 1 A LEU 143 ? A LEU 143 138 18 Y 1 A GLU 144 ? A GLU 144 139 18 Y 1 A HIS 145 ? A HIS 145 140 18 Y 1 A HIS 146 ? A HIS 146 141 18 Y 1 A HIS 147 ? A HIS 147 142 18 Y 1 A HIS 148 ? A HIS 148 143 18 Y 1 A HIS 149 ? A HIS 149 144 18 Y 1 A HIS 150 ? A HIS 150 145 19 Y 1 A LEU 143 ? A LEU 143 146 19 Y 1 A GLU 144 ? A GLU 144 147 19 Y 1 A HIS 145 ? A HIS 145 148 19 Y 1 A HIS 146 ? A HIS 146 149 19 Y 1 A HIS 147 ? A HIS 147 150 19 Y 1 A HIS 148 ? A HIS 148 151 19 Y 1 A HIS 149 ? A HIS 149 152 19 Y 1 A HIS 150 ? A HIS 150 153 20 Y 1 A LEU 143 ? A LEU 143 154 20 Y 1 A GLU 144 ? A GLU 144 155 20 Y 1 A HIS 145 ? A HIS 145 156 20 Y 1 A HIS 146 ? A HIS 146 157 20 Y 1 A HIS 147 ? A HIS 147 158 20 Y 1 A HIS 148 ? A HIS 148 159 20 Y 1 A HIS 149 ? A HIS 149 160 20 Y 1 A HIS 150 ? A HIS 150 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Varian INOVA 1 'Varian INOVA' 600 Varian INOVA 2 'Varian INOVA' 600 Bruker AVANCE 3 'Bruker Avance' 600 Bruker AVANCE 4 'Bruker Avance' # _atom_sites.entry_id 2LLX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_