data_2LM2 # _entry.id 2LM2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LM2 RCSB RCSB102548 BMRB 18096 WWPDB D_1000102548 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18096 BMRB unspecified . 2LLY PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LM2 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-11-18 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bondarenko, V.' 1 'Mowrey, D.' 2 'Tillman, T.' 3 'Cui, T.' 4 'Liu, L.T.' 5 'Xu, Y.' 6 'Tang, P.' 7 # _citation.id primary _citation.title 'NMR structures of the transmembrane domains of the a4b2 nAChR.' _citation.journal_abbrev Biochim.Biophys.Acta _citation.journal_volume 1818 _citation.page_first 1261 _citation.page_last 1268 _citation.year 2012 _citation.journal_id_ASTM BBACAQ _citation.country NE _citation.journal_id_ISSN 0006-3002 _citation.journal_id_CSD 0113 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22361591 _citation.pdbx_database_id_DOI 10.1016/j.bbamem.2012.02.008 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Bondarenko, V.' 1 primary 'Mowrey, D.' 2 primary 'Tillman, T.' 3 primary 'Cui, T.' 4 primary 'Liu, L.T.' 5 primary 'Xu, Y.' 6 primary 'Tang, P.' 7 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Neuronal acetylcholine receptor subunit beta-2' _entity.formula_weight 15085.798 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'R231E, R232E, K233E, L292S, V294S, L296S, K299E, T327E' _entity.pdbx_fragment 'Helical transmembrane region, residues 234-330 and residues 458-484' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNAEEEPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSSDSPSVGEYLMFTMVL VTFSIVTSVCVLNVHHRSPETHTGGGGGIDRLFLWIFVFVCVFGTIGMFLQPLFQEE ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAEEEPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSSDSPSVGEYLMFTMVL VTFSIVTSVCVLNVHHRSPETHTGGGGGIDRLFLWIFVFVCVFGTIGMFLQPLFQEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 GLU n 1 5 GLU n 1 6 GLU n 1 7 PRO n 1 8 LEU n 1 9 PHE n 1 10 TYR n 1 11 THR n 1 12 ILE n 1 13 ASN n 1 14 LEU n 1 15 ILE n 1 16 ILE n 1 17 PRO n 1 18 CYS n 1 19 VAL n 1 20 LEU n 1 21 ILE n 1 22 THR n 1 23 SER n 1 24 LEU n 1 25 ALA n 1 26 ILE n 1 27 LEU n 1 28 VAL n 1 29 PHE n 1 30 TYR n 1 31 LEU n 1 32 PRO n 1 33 SER n 1 34 ASP n 1 35 CYS n 1 36 GLY n 1 37 GLU n 1 38 LYS n 1 39 MET n 1 40 THR n 1 41 LEU n 1 42 CYS n 1 43 ILE n 1 44 SER n 1 45 VAL n 1 46 LEU n 1 47 LEU n 1 48 ALA n 1 49 LEU n 1 50 THR n 1 51 VAL n 1 52 PHE n 1 53 LEU n 1 54 LEU n 1 55 LEU n 1 56 ILE n 1 57 SER n 1 58 LYS n 1 59 ILE n 1 60 VAL n 1 61 PRO n 1 62 PRO n 1 63 THR n 1 64 SER n 1 65 SER n 1 66 ASP n 1 67 SER n 1 68 PRO n 1 69 SER n 1 70 VAL n 1 71 GLY n 1 72 GLU n 1 73 TYR n 1 74 LEU n 1 75 MET n 1 76 PHE n 1 77 THR n 1 78 MET n 1 79 VAL n 1 80 LEU n 1 81 VAL n 1 82 THR n 1 83 PHE n 1 84 SER n 1 85 ILE n 1 86 VAL n 1 87 THR n 1 88 SER n 1 89 VAL n 1 90 CYS n 1 91 VAL n 1 92 LEU n 1 93 ASN n 1 94 VAL n 1 95 HIS n 1 96 HIS n 1 97 ARG n 1 98 SER n 1 99 PRO n 1 100 GLU n 1 101 THR n 1 102 HIS n 1 103 THR n 1 104 GLY n 1 105 GLY n 1 106 GLY n 1 107 GLY n 1 108 GLY n 1 109 ILE n 1 110 ASP n 1 111 ARG n 1 112 LEU n 1 113 PHE n 1 114 LEU n 1 115 TRP n 1 116 ILE n 1 117 PHE n 1 118 VAL n 1 119 PHE n 1 120 VAL n 1 121 CYS n 1 122 VAL n 1 123 PHE n 1 124 GLY n 1 125 THR n 1 126 ILE n 1 127 GLY n 1 128 MET n 1 129 PHE n 1 130 LEU n 1 131 GLN n 1 132 PRO n 1 133 LEU n 1 134 PHE n 1 135 GLN n 1 136 GLU n 1 137 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CHRNB2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pTBSG1 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP ACHB2_HUMAN P17787 1 ;RRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTF SIVTSVCVLNVHHRSPTTHT ; 231 ? 2 UNP ACHB2_HUMAN P17787 1 IDRLFLWIFVFVCVFGTIGMFLQPLFQNY 458 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LM2 A 4 ? 103 ? P17787 231 ? 330 ? 4 103 2 2 2LM2 A 109 ? 137 ? P17787 458 ? 486 ? 109 137 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LM2 SER A 1 ? UNP P17787 ? ? 'EXPRESSION TAG' 1 1 1 2LM2 ASN A 2 ? UNP P17787 ? ? 'EXPRESSION TAG' 2 2 1 2LM2 ALA A 3 ? UNP P17787 ? ? 'EXPRESSION TAG' 3 3 1 2LM2 GLU A 4 ? UNP P17787 ARG 231 'ENGINEERED MUTATION' 4 4 1 2LM2 GLU A 5 ? UNP P17787 ARG 232 'ENGINEERED MUTATION' 5 5 1 2LM2 GLU A 6 ? UNP P17787 LYS 233 'ENGINEERED MUTATION' 6 6 1 2LM2 SER A 65 ? UNP P17787 LEU 292 'ENGINEERED MUTATION' 65 7 1 2LM2 SER A 67 ? UNP P17787 VAL 294 'ENGINEERED MUTATION' 67 8 1 2LM2 SER A 69 ? UNP P17787 LEU 296 'ENGINEERED MUTATION' 69 9 1 2LM2 GLU A 72 ? UNP P17787 LYS 299 'ENGINEERED MUTATION' 72 10 1 2LM2 GLU A 100 ? UNP P17787 THR 327 'ENGINEERED MUTATION' 100 11 1 2LM2 GLY A 104 ? UNP P17787 ? ? LINKER 104 12 1 2LM2 GLY A 105 ? UNP P17787 ? ? LINKER 105 13 1 2LM2 GLY A 106 ? UNP P17787 ? ? LINKER 106 14 1 2LM2 GLY A 107 ? UNP P17787 ? ? LINKER 107 15 1 2LM2 GLY A 108 ? UNP P17787 ? ? LINKER 108 16 2 2LM2 GLU A 136 ? UNP P17787 ASN 485 'ENGINEERED MUTATION' 136 17 2 2LM2 GLU A 137 ? UNP P17787 TYR 486 'ENGINEERED MUTATION' 137 18 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-15N NOESY' 1 3 1 '3D 1H-13C NOESY' 1 4 1 '3D HNCA' 1 5 1 '3D HN(CO)CA' 1 6 1 '3D HNCO' 1 7 1 '2D 1H-15N HSQC' 1 8 1 '2D 1H-13C HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 4.65 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 318 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.25 mM [U-100% 13C; U-100% 15N] protein, 5 mM sodium acetate, 1.5 % LDAO, 0.1 mM DSS, 5 % [U-100% 2H] D2O, 10 mM sodium chloride, 20 mM beta-mercaptoethanol, 95% H2O/5% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker Avance 1 'Bruker Avance' 700 Bruker Avance 2 'Bruker Avance' 800 Bruker Avance 3 'Bruker Avance' 900 Bruker Avance 4 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LM2 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LM2 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LM2 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 1 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LM2 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LM2 _struct.title 'NMR structures of the transmembrane domains of the AChR b2 subunit' _struct.pdbx_descriptor 'Neuronal acetylcholine receptor subunit beta-2' _struct.pdbx_model_details 'closest to the average, model 17' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LM2 _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text 'Acetylcholine receptor, Transmembrane domain, TRANSPORT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 7 ? LEU A 31 ? PRO A 7 LEU A 31 1 ? 25 HELX_P HELX_P2 2 CYS A 35 ? ILE A 59 ? CYS A 35 ILE A 59 1 ? 25 HELX_P HELX_P3 3 PRO A 61 ? SER A 65 ? PRO A 61 SER A 65 5 ? 5 HELX_P HELX_P4 4 SER A 69 ? ASN A 93 ? SER A 69 ASN A 93 1 ? 25 HELX_P HELX_P5 5 GLY A 108 ? LEU A 130 ? GLY A 108 LEU A 130 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2LM2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 MET 75 75 75 MET MET A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 CYS 121 121 121 CYS CYS A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 MET 128 128 128 MET MET A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 GLN 135 135 135 GLN GLN A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 GLU 137 137 137 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2012-03-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 0.25 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium acetate-2' 5 ? mM ? 1 LDAO-3 1.5 ? % ? 1 DSS-4 0.1 ? mM ? 1 D2O-5 5 ? % '[U-100% 2H]' 1 'sodium chloride-6' 10 ? mM ? 1 beta-mercaptoethanol-7 20 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LM2 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 292 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 766 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 328 _pdbx_nmr_constraints.NOE_long_range_total_count 35 _pdbx_nmr_constraints.NOE_medium_range_total_count 114 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 289 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 92 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 92 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 31 ? ? -116.07 71.69 2 1 PRO A 32 ? ? -69.72 81.58 3 1 ASP A 34 ? ? 60.80 -177.19 4 1 VAL A 60 ? ? 64.93 75.07 5 1 SER A 64 ? ? -156.97 27.28 6 1 ARG A 97 ? ? 59.56 176.32 7 1 HIS A 102 ? ? -61.35 -172.29 8 1 PHE A 134 ? ? -174.77 -178.22 9 1 GLU A 136 ? ? -108.46 63.61 10 2 PRO A 32 ? ? -69.73 97.15 11 2 ILE A 59 ? ? 65.94 108.46 12 2 VAL A 60 ? ? -157.45 69.26 13 2 SER A 64 ? ? -59.67 99.08 14 2 HIS A 95 ? ? -155.40 -54.70 15 2 HIS A 96 ? ? 60.03 97.35 16 2 PHE A 134 ? ? -174.65 -179.20 17 2 GLU A 136 ? ? -104.01 56.12 18 3 PRO A 32 ? ? -69.73 85.38 19 3 SER A 67 ? ? 61.91 71.81 20 3 HIS A 96 ? ? 58.07 77.39 21 3 ARG A 97 ? ? 62.03 -176.80 22 3 PHE A 134 ? ? -177.93 -177.59 23 3 GLU A 136 ? ? -92.41 51.51 24 4 ALA A 3 ? ? -164.31 43.96 25 4 LEU A 31 ? ? -119.90 68.68 26 4 PRO A 32 ? ? -69.83 80.55 27 4 SER A 65 ? ? 62.33 177.99 28 4 ASN A 93 ? ? -178.70 134.40 29 4 THR A 103 ? ? -145.71 55.14 30 4 GLU A 136 ? ? 58.45 82.18 31 5 PRO A 32 ? ? -69.75 83.69 32 5 SER A 65 ? ? -57.61 171.59 33 5 PRO A 68 ? ? -69.81 -175.44 34 5 SER A 69 ? ? -132.28 -60.91 35 5 VAL A 94 ? ? -171.56 141.07 36 5 THR A 101 ? ? -69.56 99.41 37 5 GLU A 136 ? ? 56.53 73.49 38 6 GLU A 6 ? ? 178.55 -59.24 39 6 ILE A 59 ? ? 65.93 110.86 40 6 THR A 63 ? ? -170.39 -38.31 41 6 ASP A 66 ? ? -171.58 -41.17 42 6 ARG A 97 ? ? 62.02 175.37 43 7 SER A 64 ? ? -172.02 147.51 44 7 SER A 67 ? ? -152.18 69.68 45 7 THR A 101 ? ? -174.92 86.85 46 7 PHE A 134 ? ? -171.30 -178.03 47 7 GLU A 136 ? ? 59.84 78.06 48 8 GLU A 6 ? ? 178.52 -59.19 49 8 LEU A 31 ? ? -116.00 71.02 50 8 SER A 65 ? ? -178.24 114.90 51 8 ASP A 66 ? ? 58.81 91.97 52 8 SER A 67 ? ? 60.14 72.26 53 8 ASN A 93 ? ? -172.26 125.74 54 8 HIS A 95 ? ? -165.93 -49.50 55 8 ARG A 97 ? ? -145.78 24.39 56 8 PHE A 134 ? ? -173.07 -179.21 57 8 GLU A 136 ? ? 56.78 77.55 58 9 GLU A 5 ? ? 60.91 94.87 59 9 GLU A 6 ? ? 178.55 -59.17 60 9 SER A 64 ? ? -166.76 79.66 61 9 SER A 65 ? ? -122.00 -67.97 62 9 PRO A 68 ? ? -69.80 -179.37 63 9 SER A 69 ? ? -143.68 -68.69 64 9 HIS A 95 ? ? -172.47 132.59 65 9 GLU A 136 ? ? 55.26 90.89 66 10 LEU A 31 ? ? -118.71 70.44 67 10 ILE A 59 ? ? 66.13 149.31 68 10 SER A 64 ? ? -178.98 -171.13 69 10 ASP A 66 ? ? -179.13 -177.66 70 10 SER A 69 ? ? 63.01 89.91 71 10 HIS A 95 ? ? -163.63 118.30 72 10 HIS A 102 ? ? -127.31 -73.74 73 10 PHE A 134 ? ? -173.05 -179.06 74 10 GLU A 136 ? ? 56.21 85.12 75 11 ILE A 59 ? ? 65.91 111.77 76 11 VAL A 60 ? ? -119.18 73.04 77 11 THR A 63 ? ? -161.78 31.02 78 11 SER A 64 ? ? 62.93 103.71 79 11 SER A 65 ? ? -160.68 -72.62 80 11 HIS A 95 ? ? -166.51 61.83 81 11 HIS A 96 ? ? -152.28 -54.36 82 11 PHE A 134 ? ? -174.53 -77.43 83 11 GLU A 136 ? ? 56.03 92.69 84 12 GLU A 5 ? ? -99.43 42.20 85 12 GLU A 100 ? ? -176.48 144.75 86 12 THR A 101 ? ? -55.01 172.28 87 12 PHE A 134 ? ? -174.29 -77.40 88 12 GLU A 136 ? ? 55.41 84.09 89 13 ASP A 34 ? ? -98.48 45.32 90 13 ILE A 59 ? ? -119.81 62.18 91 13 SER A 65 ? ? -164.16 -73.42 92 13 ASP A 66 ? ? -129.07 -53.94 93 13 SER A 67 ? ? -117.44 70.33 94 13 ASN A 93 ? ? -174.92 149.13 95 13 SER A 98 ? ? 63.08 160.54 96 13 HIS A 102 ? ? -125.37 -64.99 97 13 GLU A 136 ? ? 53.42 72.67 98 14 ALA A 3 ? ? 58.59 94.88 99 14 ASP A 34 ? ? -116.54 -74.29 100 14 SER A 67 ? ? -171.84 70.13 101 14 SER A 69 ? ? -145.59 24.83 102 14 HIS A 96 ? ? 62.79 163.83 103 14 ARG A 97 ? ? -170.05 124.15 104 14 GLU A 136 ? ? 57.97 74.96 105 15 ALA A 3 ? ? -168.66 100.90 106 15 ASP A 34 ? ? 63.13 167.68 107 15 ILE A 59 ? ? 65.92 111.90 108 15 THR A 63 ? ? -176.36 -37.79 109 15 ASP A 66 ? ? -177.40 -42.34 110 15 HIS A 96 ? ? -160.15 90.82 111 15 PHE A 134 ? ? 180.00 -77.67 112 16 ALA A 3 ? ? -59.22 108.42 113 16 GLU A 5 ? ? 54.98 90.91 114 16 GLU A 6 ? ? 178.56 -59.20 115 16 SER A 65 ? ? -124.02 -62.49 116 16 SER A 67 ? ? 52.46 73.06 117 16 PRO A 68 ? ? -69.78 -177.92 118 16 SER A 69 ? ? -139.31 -74.35 119 16 HIS A 96 ? ? 58.42 85.35 120 16 GLU A 100 ? ? 61.16 98.46 121 16 PHE A 134 ? ? -172.44 -179.00 122 17 ALA A 3 ? ? -156.44 70.44 123 17 ASP A 34 ? ? 61.08 174.08 124 17 VAL A 60 ? ? -113.45 74.20 125 17 SER A 67 ? ? 63.02 70.88 126 17 HIS A 96 ? ? 62.92 171.13 127 17 GLU A 136 ? ? 56.10 72.72 128 18 GLU A 5 ? ? 62.86 104.11 129 18 GLU A 6 ? ? 178.57 -59.26 130 18 PRO A 32 ? ? -69.75 81.10 131 18 SER A 65 ? ? -170.10 -51.59 132 18 PHE A 134 ? ? -171.78 -177.33 133 19 PRO A 32 ? ? -69.74 96.49 134 19 VAL A 60 ? ? -113.43 74.27 135 19 ASP A 66 ? ? 59.97 94.79 136 19 SER A 67 ? ? 56.04 70.88 137 19 HIS A 95 ? ? -176.80 -46.51 138 19 GLU A 136 ? ? 55.22 89.42 139 20 ALA A 3 ? ? -177.35 -49.54 140 20 PRO A 32 ? ? -69.73 92.96 141 20 ASP A 34 ? ? 62.45 171.98 142 20 ILE A 59 ? ? -119.80 63.09 143 20 THR A 63 ? ? -172.25 115.13 144 20 SER A 67 ? ? 53.35 71.54 145 20 HIS A 96 ? ? 61.72 169.62 146 20 PHE A 134 ? ? -173.88 -77.49 147 20 GLU A 136 ? ? 52.49 83.06 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 2 Y 1 A SER 1 ? A SER 1 3 3 Y 1 A SER 1 ? A SER 1 4 4 Y 1 A SER 1 ? A SER 1 5 5 Y 1 A SER 1 ? A SER 1 6 6 Y 1 A SER 1 ? A SER 1 7 7 Y 1 A SER 1 ? A SER 1 8 8 Y 1 A SER 1 ? A SER 1 9 9 Y 1 A SER 1 ? A SER 1 10 10 Y 1 A SER 1 ? A SER 1 11 11 Y 1 A SER 1 ? A SER 1 12 12 Y 1 A SER 1 ? A SER 1 13 13 Y 1 A SER 1 ? A SER 1 14 14 Y 1 A SER 1 ? A SER 1 15 15 Y 1 A SER 1 ? A SER 1 16 16 Y 1 A SER 1 ? A SER 1 17 17 Y 1 A SER 1 ? A SER 1 18 18 Y 1 A SER 1 ? A SER 1 19 19 Y 1 A SER 1 ? A SER 1 20 20 Y 1 A SER 1 ? A SER 1 #