data_2LN8 # _entry.id 2LN8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LN8 pdb_00002ln8 10.2210/pdb2ln8/pdb RCSB RCSB102590 ? ? BMRB 18153 ? ? WWPDB D_1000102590 ? ? # _pdbx_database_related.db_id 18153 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LN8 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-12-20 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jung, S.' 1 'Soennichsen, F.D.' 2 'Hung, C.-W.' 3 'Tholey, A.' 4 'Boidin-Wichlacz, C.' 5 'Hausgen, W.' 6 'Gelhaus, C.' 7 'Desel, C.' 8 'Podschun, R.' 9 'Watzig, V.' 10 'Tasiemski, A.' 11 'Leippe, M.' 12 'Groetzinger, J.' 13 # _citation.id primary _citation.title 'Macin family of antimicrobial proteins combines antimicrobial and nerve repair activities.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 287 _citation.page_first 14246 _citation.page_last 14258 _citation.year 2012 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22396551 _citation.pdbx_database_id_DOI 10.1074/jbc.M111.336495 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jung, S.' 1 ? primary 'Sonnichsen, F.D.' 2 ? primary 'Hung, C.W.' 3 ? primary 'Tholey, A.' 4 ? primary 'Boidin-Wichlacz, C.' 5 ? primary 'Haeusgen, W.' 6 ? primary 'Gelhaus, C.' 7 ? primary 'Desel, C.' 8 ? primary 'Podschun, R.' 9 ? primary 'Waetzig, V.' 10 ? primary 'Tasiemski, A.' 11 ? primary 'Leippe, M.' 12 ? primary 'Grotzinger, J.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Theromacin _entity.formula_weight 8465.528 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GCFEDWSRCSPSTASATGVLWRSCDSYCKVCFKADRGECYDSPSLNCPHRLPNNKQCRCINARTAKDNRNPTCWA _entity_poly.pdbx_seq_one_letter_code_can GCFEDWSRCSPSTASATGVLWRSCDSYCKVCFKADRGECYDSPSLNCPHRLPNNKQCRCINARTAKDNRNPTCWA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 CYS n 1 3 PHE n 1 4 GLU n 1 5 ASP n 1 6 TRP n 1 7 SER n 1 8 ARG n 1 9 CYS n 1 10 SER n 1 11 PRO n 1 12 SER n 1 13 THR n 1 14 ALA n 1 15 SER n 1 16 ALA n 1 17 THR n 1 18 GLY n 1 19 VAL n 1 20 LEU n 1 21 TRP n 1 22 ARG n 1 23 SER n 1 24 CYS n 1 25 ASP n 1 26 SER n 1 27 TYR n 1 28 CYS n 1 29 LYS n 1 30 VAL n 1 31 CYS n 1 32 PHE n 1 33 LYS n 1 34 ALA n 1 35 ASP n 1 36 ARG n 1 37 GLY n 1 38 GLU n 1 39 CYS n 1 40 TYR n 1 41 ASP n 1 42 SER n 1 43 PRO n 1 44 SER n 1 45 LEU n 1 46 ASN n 1 47 CYS n 1 48 PRO n 1 49 HIS n 1 50 ARG n 1 51 LEU n 1 52 PRO n 1 53 ASN n 1 54 ASN n 1 55 LYS n 1 56 GLN n 1 57 CYS n 1 58 ARG n 1 59 CYS n 1 60 ILE n 1 61 ASN n 1 62 ALA n 1 63 ARG n 1 64 THR n 1 65 ALA n 1 66 LYS n 1 67 ASP n 1 68 ASN n 1 69 ARG n 1 70 ASN n 1 71 PRO n 1 72 THR n 1 73 CYS n 1 74 TRP n 1 75 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Medicinal leech' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hirudo medicinalis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6421 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET-32a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code THMAC_HIRME _struct_ref.pdbx_db_accession A8I0L8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GCFEDWSRCSPSTASATGVLWRSCDSYCKVCFKADRGECYDSPSLNCPHRLPNNKQCRCINARTAKDNRNPTCWA _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LN8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A8I0L8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 75 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '3D HNCA' 1 3 1 '3D HNCO' 1 4 1 '3D C(CO)NH' 1 5 1 '3D H(CCO)NH' 1 6 1 '3D HN(CO)CA' 1 7 1 '3D HNCACB' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-15N TOCSY' 1 10 1 '3D HCCH-TOCSY' 1 11 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.02 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM [U-99% 13C; U-99% 15N] protein, 93% H2O/7% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LN8 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LN8 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LN8 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'chemical shift assignment' NMRPipe ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'structure solution' NMRPipe ? 3 'Johnson, One Moon Scientific' processing NMRView ? 4 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 5 'Johnson, One Moon Scientific' 'structure solution' NMRView ? 6 'Guntert, Mumenthaler and Wuthrich' processing CYANA ? 7 'Guntert, Mumenthaler and Wuthrich' 'chemical shift assignment' CYANA ? 8 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 9 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 10 'Brunger, Adams, Clore, Gros, Nilges and Read' processing CNS ? 11 'Brunger, Adams, Clore, Gros, Nilges and Read' 'chemical shift assignment' CNS ? 12 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 13 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 14 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'The solution structure of Thermomacin' _exptl.entry_id 2LN8 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LN8 _struct.title 'The solution structure of theromacin' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LN8 _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' _struct_keywords.text 'antimicrobial peptide, ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 2 ? SER A 7 ? CYS A 2 SER A 7 1 ? 6 HELX_P HELX_P2 2 CYS A 24 ? CYS A 31 ? CYS A 24 CYS A 31 1 ? 8 HELX_P HELX_P3 3 ASN A 70 ? TRP A 74 ? ASN A 70 TRP A 74 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 2 A CYS 47 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 9 A CYS 39 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf3 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 57 SG ? ? A CYS 24 A CYS 57 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf4 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 28 A CYS 59 1_555 ? ? ? ? ? ? ? 2.039 ? ? disulf5 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 73 SG ? ? A CYS 31 A CYS 73 1_555 ? ? ? ? ? ? ? 2.013 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 36 ? CYS A 39 ? ARG A 36 CYS A 39 A 2 CYS A 57 ? ILE A 60 ? CYS A 57 ILE A 60 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 36 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 36 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 60 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 60 # _atom_sites.entry_id 2LN8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 TRP 74 74 74 TRP TRP A . n A 1 75 ALA 75 75 75 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-03-14 2 'Structure model' 1 1 2012-05-09 3 'Structure model' 1 2 2015-08-19 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_exptl_sample.component entity-1 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 8 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 PRO _pdbx_validate_rmsd_angle.auth_seq_id_1 52 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 52 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 52 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 102.97 _pdbx_validate_rmsd_angle.angle_target_value 111.70 _pdbx_validate_rmsd_angle.angle_deviation -8.73 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.40 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 11 ? ? -68.09 91.45 2 1 SER A 12 ? ? -145.38 -76.61 3 1 ALA A 16 ? ? -173.67 144.27 4 1 LEU A 20 ? ? 81.20 -13.71 5 1 CYS A 24 ? ? -84.59 -115.00 6 1 LYS A 33 ? ? 35.93 47.41 7 1 HIS A 49 ? ? 70.58 153.23 8 2 PRO A 11 ? ? -68.95 13.41 9 2 THR A 13 ? ? -121.48 -67.14 10 2 VAL A 19 ? ? -90.06 -90.32 11 2 SER A 23 ? ? 157.36 156.88 12 2 PRO A 48 ? ? -65.49 93.24 13 2 PRO A 52 ? ? -36.14 -13.56 14 2 CYS A 57 ? ? -173.30 136.13 15 3 PRO A 11 ? ? -61.80 9.95 16 3 THR A 13 ? ? 77.35 -47.24 17 3 ALA A 14 ? ? 40.99 -92.52 18 3 LEU A 20 ? ? 72.27 -64.47 19 3 SER A 23 ? ? 66.12 107.35 20 3 LYS A 33 ? ? 39.94 46.88 21 3 PRO A 52 ? ? -30.05 -8.11 22 4 PRO A 11 ? ? -49.68 95.00 23 4 THR A 13 ? ? -141.00 23.45 24 4 ALA A 14 ? ? -147.87 36.54 25 4 THR A 17 ? ? -103.78 -69.61 26 4 TRP A 21 ? ? -65.87 -96.61 27 4 SER A 23 ? ? 59.05 -104.77 28 4 CYS A 24 ? ? -166.23 -50.12 29 4 LYS A 33 ? ? 38.14 41.27 30 4 ASN A 46 ? ? -150.54 32.12 31 4 ARG A 50 ? ? -86.40 39.69 32 4 PRO A 52 ? ? -38.97 -1.31 33 5 PRO A 11 ? ? -79.03 47.35 34 5 ALA A 14 ? ? -178.23 -165.51 35 5 THR A 17 ? ? -93.98 -60.43 36 5 LEU A 20 ? ? 63.48 -66.75 37 5 SER A 23 ? ? 61.96 -166.99 38 5 ASN A 46 ? ? -68.95 97.14 39 5 PRO A 48 ? ? -86.09 47.41 40 5 LEU A 51 ? ? 36.06 39.15 41 5 ASN A 54 ? ? -75.18 41.72 42 6 SER A 12 ? ? -143.52 -49.15 43 6 SER A 23 ? ? 68.16 107.93 44 6 ARG A 50 ? ? -177.06 34.81 45 6 LYS A 55 ? ? -18.93 85.80 46 7 THR A 17 ? ? -179.58 -177.91 47 7 VAL A 19 ? ? -48.70 -76.82 48 7 SER A 23 ? ? 76.26 158.72 49 7 LYS A 33 ? ? 37.22 59.10 50 7 SER A 42 ? ? -38.10 125.56 51 7 LEU A 45 ? ? 46.24 84.74 52 7 LEU A 51 ? ? 44.66 82.55 53 7 ASN A 53 ? ? -126.33 -53.92 54 7 ASN A 54 ? ? 44.75 -57.99 55 7 LYS A 55 ? ? 24.20 75.63 56 7 LYS A 66 ? ? -37.64 117.84 57 8 THR A 13 ? ? -153.44 -51.97 58 8 VAL A 19 ? ? -168.30 -87.02 59 8 SER A 23 ? ? 62.20 96.31 60 8 ASN A 46 ? ? -52.46 99.41 61 8 PRO A 52 ? ? 22.47 -2.93 62 9 PRO A 11 ? ? -65.89 78.23 63 9 SER A 12 ? ? -148.94 -57.77 64 9 THR A 13 ? ? -156.54 77.05 65 9 VAL A 19 ? ? -93.25 -78.57 66 9 SER A 23 ? ? 148.42 118.84 67 9 CYS A 39 ? ? -85.79 38.50 68 9 PRO A 48 ? ? -68.65 82.51 69 9 LYS A 55 ? ? -15.45 83.03 70 10 ARG A 8 ? ? -68.14 9.09 71 10 PRO A 11 ? ? -66.22 92.04 72 10 ALA A 14 ? ? 66.63 -75.49 73 10 SER A 15 ? ? -154.25 -72.13 74 10 TRP A 21 ? ? 65.76 68.96 75 10 CYS A 24 ? ? -89.20 -105.96 76 10 SER A 42 ? ? -38.54 109.85 77 10 HIS A 49 ? ? 53.11 -162.13 78 10 ARG A 50 ? ? 79.52 -59.43 79 10 ASN A 54 ? ? -75.60 43.15 80 10 CYS A 57 ? ? -170.28 137.41 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 ARG A 8 ? ? 0.078 'SIDE CHAIN' 2 3 ARG A 69 ? ? 0.119 'SIDE CHAIN' 3 7 ARG A 50 ? ? 0.104 'SIDE CHAIN' #