data_2LNB # _entry.id 2LNB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LNB RCSB RCSB102593 BMRB 18158 WWPDB D_1000102593 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18158 BMRB unspecified . HR8174A TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LNB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-12-20 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yang, Y.' 1 'Ramelot, T.A.' 2 'Hamilton, K.' 3 'Kohan, E.' 4 'Wang, D.' 5 'Acton, T.B.' 6 'Xiao, R.' 7 'Everett, J.K.' 8 'Montelione, G.T.' 9 'Kennedy, M.A.' 10 'Northeast Structural Genomics Consortium (NESG)' 11 # _citation.id primary _citation.title 'Solution NMR structure of N-terminal domain (6-74) of human ZBP1 protein, Northeast Structural Genomics Consortium Target HR8174A' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yang, Y.' 1 primary 'Ramelot, T.A.' 2 primary 'Hamilton, K.' 3 primary 'Kohan, E.' 4 primary 'Wang, D.' 5 primary 'Acton, T.B.' 6 primary 'Xiao, R.' 7 primary 'Everett, J.K.' 8 primary 'Montelione, G.T.' 9 primary 'Kennedy, M.A.' 10 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Z-DNA-binding protein 1' _entity.formula_weight 9041.406 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'DRADA 1 repeat region, residues 6-74' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Tumor stroma and activated macrophage protein DLM-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGHHHHHHSHMADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPE _entity_poly.pdbx_seq_one_letter_code_can MGHHHHHHSHMADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier HR8174A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 HIS n 1 11 MET n 1 12 ALA n 1 13 ASP n 1 14 PRO n 1 15 GLY n 1 16 ARG n 1 17 GLU n 1 18 GLY n 1 19 HIS n 1 20 LEU n 1 21 GLU n 1 22 GLN n 1 23 ARG n 1 24 ILE n 1 25 LEU n 1 26 GLN n 1 27 VAL n 1 28 LEU n 1 29 THR n 1 30 GLU n 1 31 ALA n 1 32 GLY n 1 33 SER n 1 34 PRO n 1 35 VAL n 1 36 LYS n 1 37 LEU n 1 38 ALA n 1 39 GLN n 1 40 LEU n 1 41 VAL n 1 42 LYS n 1 43 GLU n 1 44 CYS n 1 45 GLN n 1 46 ALA n 1 47 PRO n 1 48 LYS n 1 49 ARG n 1 50 GLU n 1 51 LEU n 1 52 ASN n 1 53 GLN n 1 54 VAL n 1 55 LEU n 1 56 TYR n 1 57 ARG n 1 58 MET n 1 59 LYS n 1 60 LYS n 1 61 GLU n 1 62 LEU n 1 63 LYS n 1 64 VAL n 1 65 SER n 1 66 LEU n 1 67 THR n 1 68 SER n 1 69 PRO n 1 70 ALA n 1 71 THR n 1 72 TRP n 1 73 CYS n 1 74 LEU n 1 75 GLY n 1 76 GLY n 1 77 THR n 1 78 ASP n 1 79 PRO n 1 80 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'C20orf183, DLM1, ZBP1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET15 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZBP1_HUMAN _struct_ref.pdbx_db_accession Q9H171 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPE _struct_ref.pdbx_align_begin 6 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LNB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 12 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 80 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H171 _struct_ref_seq.db_align_beg 6 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 74 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 12 _struct_ref_seq.pdbx_auth_seq_align_end 80 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LNB MET A 1 ? UNP Q9H171 ? ? 'EXPRESSION TAG' 1 1 1 2LNB GLY A 2 ? UNP Q9H171 ? ? 'EXPRESSION TAG' 2 2 1 2LNB HIS A 3 ? UNP Q9H171 ? ? 'EXPRESSION TAG' 3 3 1 2LNB HIS A 4 ? UNP Q9H171 ? ? 'EXPRESSION TAG' 4 4 1 2LNB HIS A 5 ? UNP Q9H171 ? ? 'EXPRESSION TAG' 5 5 1 2LNB HIS A 6 ? UNP Q9H171 ? ? 'EXPRESSION TAG' 6 6 1 2LNB HIS A 7 ? UNP Q9H171 ? ? 'EXPRESSION TAG' 7 7 1 2LNB HIS A 8 ? UNP Q9H171 ? ? 'EXPRESSION TAG' 8 8 1 2LNB SER A 9 ? UNP Q9H171 ? ? 'EXPRESSION TAG' 9 9 1 2LNB HIS A 10 ? UNP Q9H171 ? ? 'EXPRESSION TAG' 10 10 1 2LNB MET A 11 ? UNP Q9H171 ? ? 'EXPRESSION TAG' 11 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 1 '2D 1H-15N HSQC NH2 only' 1 8 2 '2D 1H-13C HSQC aliphatic' 1 9 1 '2D 1H-13C HSQC aromatic' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '3D 1H-13C NUS-NOESY aliphatic' 1 12 1 '3D HNCA' 1 13 1 '3D HN(CO)CA' 1 14 1 '3D C(CO)NH' 1 15 1 '3D HBHA(CO)NH' 1 16 1 '3D HCCH-COSY' 1 17 1 '3D HCCH-TOCSY' 1 18 1 '3D CCH-TOCSY' 1 19 1 '4D CC-NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1.0 mM [U-100% 13C; U-100% 15N] N-terminal domain (6-74) of human ZBP1 protein, 20 mM MES, 100 mM sodium chloride, 10 mM DTT, 0.02 % sodium azide, 5 mM calcium chloride, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;1.00 mM [U-5% 13C; U-100% 15N] N-terminal domain (6-74) of human ZBP1 protein, 20 mM MES, 100 mM sodium chloride, 10 mM DTT, 0.02 % sodium azide, 5 mM calcium chloride, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 850 Bruker Avance 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LNB _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 150 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LNB _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LNB _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.1 7 'Huang, Tejero, Powers and Montelione' refinement AutoStructure 2.1 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis' AutoAssign 2.1 9 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.1 10 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 11 'Bruker Biospin' collection TOPSPIN ? 12 Varian collection VNMRJ ? 13 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE ? 14 Goddard 'data analysis' SPARKY ? 15 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 16 'PALES (Zweckstetter, Bax)' 'geometry optimization' PALES ? 17 'Bhattacharya, Montelione' 'structure validation' PSVS ? 18 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LNB _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LNB _struct.title 'Solution NMR structure of N-terminal domain (6-74) of human ZBP1 protein, Northeast Structural Genomics Consortium Target HR8174A.' _struct.pdbx_descriptor 'Z-DNA-binding protein 1' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LNB _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-BIOLOGY, Protein Structure Initiative, IMMUNE SYSTEM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 2 ? HIS A 6 ? GLY A 2 HIS A 6 5 ? 5 HELX_P HELX_P2 2 GLY A 15 ? GLY A 32 ? GLY A 15 GLY A 32 1 ? 18 HELX_P HELX_P3 3 LEU A 37 ? GLN A 45 ? LEU A 37 GLN A 45 1 ? 9 HELX_P HELX_P4 4 PRO A 47 ? GLU A 61 ? PRO A 47 GLU A 61 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 35 ? LYS A 36 ? VAL A 35 LYS A 36 A 2 THR A 71 ? LEU A 74 ? THR A 71 LEU A 74 A 3 VAL A 64 ? SER A 68 ? VAL A 64 SER A 68 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 35 ? N VAL A 35 O TRP A 72 ? O TRP A 72 A 2 3 O THR A 71 ? O THR A 71 N SER A 68 ? N SER A 68 # _atom_sites.entry_id 2LNB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 TRP 72 72 72 TRP TRP A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 GLU 80 80 80 GLU GLU A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2012-01-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'N-terminal domain (6-74) of human ZBP1 protein-1' 1.0 ? mM '[U-100% 13C; U-100% 15N]' 1 MES-2 20 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 DTT-4 10 ? mM ? 1 'sodium azide-5' 0.02 ? % ? 1 'calcium chloride-6' 5 ? mM ? 1 'N-terminal domain (6-74) of human ZBP1 protein-7' 1.00 ? mM '[U-5% 13C; U-100% 15N]' 2 MES-8 20 ? mM ? 2 'sodium chloride-9' 100 ? mM ? 2 DTT-10 10 ? mM ? 2 'sodium azide-11' 0.02 ? % ? 2 'calcium chloride-12' 5 ? mM ? 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 7 ? ? -98.71 -157.71 2 1 HIS A 8 ? ? -91.74 30.06 3 1 SER A 9 ? ? 60.13 82.59 4 1 PRO A 69 ? ? -26.18 -68.57 5 1 THR A 77 ? ? -162.11 -160.48 6 1 PRO A 79 ? ? -64.65 98.66 7 2 HIS A 3 ? ? 69.29 162.29 8 2 HIS A 6 ? ? -162.04 104.62 9 2 HIS A 7 ? ? -61.03 92.32 10 2 HIS A 8 ? ? 56.13 -80.38 11 2 SER A 9 ? ? -153.18 2.00 12 2 THR A 77 ? ? -154.76 13.07 13 2 ASP A 78 ? ? 62.49 85.12 14 3 HIS A 6 ? ? -153.40 50.97 15 3 SER A 9 ? ? -79.20 22.26 16 3 ALA A 12 ? ? -65.53 94.57 17 3 ASP A 13 ? ? 65.87 116.07 18 3 PRO A 14 ? ? -72.50 32.91 19 4 HIS A 3 ? ? 70.04 147.26 20 4 HIS A 7 ? ? -143.66 -152.53 21 4 HIS A 8 ? ? 68.32 -87.31 22 4 ALA A 12 ? ? 65.06 175.50 23 4 ASP A 13 ? ? 70.54 132.39 24 4 PRO A 69 ? ? -20.37 -63.48 25 4 PRO A 79 ? ? -88.40 -158.68 26 5 HIS A 5 ? ? 58.25 -1.93 27 5 HIS A 8 ? ? -164.97 41.56 28 5 ALA A 12 ? ? -162.25 89.19 29 5 ASP A 13 ? ? -157.41 81.61 30 5 PRO A 69 ? ? -26.84 -59.51 31 5 THR A 77 ? ? -66.16 97.02 32 5 ASP A 78 ? ? 64.82 78.24 33 6 HIS A 10 ? ? -85.03 -77.25 34 6 MET A 11 ? ? -147.45 -73.63 35 6 ASP A 13 ? ? 69.32 168.96 36 6 PRO A 14 ? ? -69.55 11.75 37 6 ASP A 78 ? ? 51.50 73.51 38 7 HIS A 6 ? ? -63.46 98.71 39 7 SER A 9 ? ? -66.97 96.80 40 7 ALA A 12 ? ? -64.82 97.19 41 8 HIS A 8 ? ? -57.38 97.21 42 8 SER A 9 ? ? -164.05 119.29 43 8 HIS A 10 ? ? -62.26 98.27 44 8 MET A 11 ? ? 60.75 -83.76 45 8 ALA A 12 ? ? 57.14 19.98 46 8 PRO A 69 ? ? -43.32 106.49 47 8 THR A 77 ? ? -56.89 100.79 48 8 PRO A 79 ? ? -78.43 44.46 49 9 MET A 11 ? ? 66.38 -70.92 50 9 PRO A 14 ? ? -64.67 80.45 51 9 THR A 77 ? ? 68.25 -55.45 52 10 PRO A 69 ? ? -25.52 -63.00 53 10 THR A 77 ? ? -95.68 34.15 54 11 HIS A 3 ? ? 59.21 88.93 55 11 ALA A 12 ? ? 68.60 177.44 56 11 PRO A 69 ? ? -25.53 -59.63 57 11 THR A 77 ? ? -89.78 -155.73 58 12 HIS A 4 ? ? 66.79 -71.39 59 12 MET A 11 ? ? 67.62 90.38 60 12 ALA A 12 ? ? 65.55 104.11 61 12 PRO A 69 ? ? -25.57 -70.12 62 12 PRO A 79 ? ? -68.62 99.17 63 13 HIS A 5 ? ? 69.57 151.40 64 13 HIS A 6 ? ? -45.05 102.77 65 13 HIS A 8 ? ? -146.89 -60.42 66 13 SER A 9 ? ? 58.57 -160.55 67 13 HIS A 10 ? ? -127.78 -69.58 68 13 MET A 11 ? ? -170.69 -28.88 69 13 PRO A 69 ? ? -51.06 106.92 70 13 THR A 77 ? ? -69.87 85.64 71 14 HIS A 6 ? ? -156.34 11.93 72 14 HIS A 8 ? ? 58.76 -75.86 73 14 MET A 11 ? ? -138.98 -58.84 74 14 PRO A 69 ? ? -21.68 -67.52 75 15 HIS A 5 ? ? 68.28 97.56 76 15 ALA A 12 ? ? -160.48 21.56 77 15 ASP A 13 ? ? 76.60 115.68 78 15 PRO A 69 ? ? -29.09 -78.43 79 16 HIS A 4 ? ? -146.94 -73.62 80 16 MET A 11 ? ? 60.18 87.52 81 16 ALA A 12 ? ? 64.35 -159.61 82 16 PRO A 69 ? ? -29.68 -66.02 83 16 ASP A 78 ? ? 58.88 86.24 84 16 PRO A 79 ? ? -58.73 105.70 85 17 HIS A 5 ? ? -62.83 96.27 86 17 SER A 9 ? ? -165.33 9.37 87 17 ALA A 12 ? ? -74.51 -167.75 88 17 PRO A 79 ? ? -37.73 107.37 89 18 HIS A 7 ? ? -92.72 42.64 90 18 SER A 9 ? ? -62.14 91.98 91 18 MET A 11 ? ? 38.42 65.29 92 18 ALA A 12 ? ? -56.92 87.41 93 18 PRO A 69 ? ? -26.00 -72.76 94 18 ASP A 78 ? ? -158.16 58.40 95 18 PRO A 79 ? ? -88.56 -156.84 96 19 SER A 9 ? ? -174.55 -8.74 97 19 HIS A 10 ? ? 64.73 78.29 98 19 ALA A 12 ? ? -156.36 35.86 99 19 PRO A 14 ? ? -65.34 -130.59 100 20 HIS A 3 ? ? 63.54 -84.62 101 20 HIS A 7 ? ? 49.53 -66.46 102 20 HIS A 8 ? ? 74.29 -16.50 103 20 MET A 11 ? ? 70.51 -68.33 104 20 ASP A 13 ? ? 72.71 141.35 105 20 PRO A 69 ? ? -22.97 -70.94 #