data_2LNM # _entry.id 2LNM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LNM pdb_00002lnm 10.2210/pdb2lnm/pdb RCSB RCSB102604 ? ? BMRB 18171 ? 10.13018/BMR18171 WWPDB D_1000102604 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-11-14 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LNM _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2012-01-01 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 18171 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chen, C.' 1 'Kao, Y.' 2 # _citation.id primary _citation.title 'Solution structure of the C-terminal NP-repeat domain of Tic40, a co-chaperone during protein import into chloroplasts.' _citation.journal_abbrev J.Biochem. _citation.journal_volume 152 _citation.page_first 443 _citation.page_last 451 _citation.year 2012 _citation.journal_id_ASTM ? _citation.country JP _citation.journal_id_ISSN 0021-924X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22888115 _citation.pdbx_database_id_DOI 10.1093/jb/mvs086 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kao, Y.F.' 1 ? primary 'Lou, Y.C.' 2 ? primary 'Yeh, Y.H.' 3 ? primary 'Hsiao, C.D.' 4 ? primary 'Chen, C.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein TIC 40, chloroplastic' _entity.formula_weight 7056.141 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP RESIDUES 386-447' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein PIGMENT DEFECTIVE EMBRYO 120, Translocon at the inner envelope membrane of chloroplasts 40, AtTIC40' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code PEEVISKIMENPDVAMAFQNPRVQAALMECSENPMNIMKYQNDKEVMDVFNKISQLFPGMTG _entity_poly.pdbx_seq_one_letter_code_can PEEVISKIMENPDVAMAFQNPRVQAALMECSENPMNIMKYQNDKEVMDVFNKISQLFPGMTG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 GLU n 1 3 GLU n 1 4 VAL n 1 5 ILE n 1 6 SER n 1 7 LYS n 1 8 ILE n 1 9 MET n 1 10 GLU n 1 11 ASN n 1 12 PRO n 1 13 ASP n 1 14 VAL n 1 15 ALA n 1 16 MET n 1 17 ALA n 1 18 PHE n 1 19 GLN n 1 20 ASN n 1 21 PRO n 1 22 ARG n 1 23 VAL n 1 24 GLN n 1 25 ALA n 1 26 ALA n 1 27 LEU n 1 28 MET n 1 29 GLU n 1 30 CYS n 1 31 SER n 1 32 GLU n 1 33 ASN n 1 34 PRO n 1 35 MET n 1 36 ASN n 1 37 ILE n 1 38 MET n 1 39 LYS n 1 40 TYR n 1 41 GLN n 1 42 ASN n 1 43 ASP n 1 44 LYS n 1 45 GLU n 1 46 VAL n 1 47 MET n 1 48 ASP n 1 49 VAL n 1 50 PHE n 1 51 ASN n 1 52 LYS n 1 53 ILE n 1 54 SER n 1 55 GLN n 1 56 LEU n 1 57 PHE n 1 58 PRO n 1 59 GLY n 1 60 MET n 1 61 THR n 1 62 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'mouse-ear cress,thale-cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TIC40, PDE120, At5g16620, MTG13.6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET15b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'NdeI, XhoI' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLY 62 62 62 GLY GLY A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LNM _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LNM _struct.title 'Solution structure of the C-terminal NP-repeat domain of Tic40, a co-chaperone during protein import into chloroplasts' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LNM _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' _struct_keywords.text 'translocon, import, chloroplast, Tic40-NP, PROTEIN TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TIC40_ARATH _struct_ref.pdbx_db_accession Q9FMD5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PEEVISKIMENPDVAMAFQNPRVQAALMECSENPMNIMKYQNDKEVMDVFNKISQLFPGMTG _struct_ref.pdbx_align_begin 386 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LNM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 62 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9FMD5 _struct_ref_seq.db_align_beg 386 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 447 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 62 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 1 ? MET A 9 ? PRO A 1 MET A 9 1 ? 9 HELX_P HELX_P2 2 ASN A 11 ? PHE A 18 ? ASN A 11 PHE A 18 1 ? 8 HELX_P HELX_P3 3 ASN A 20 ? SER A 31 ? ASN A 20 SER A 31 1 ? 12 HELX_P HELX_P4 4 GLU A 32 ? MET A 35 ? GLU A 32 MET A 35 5 ? 4 HELX_P HELX_P5 5 ASN A 36 ? GLN A 41 ? ASN A 36 GLN A 41 1 ? 6 HELX_P HELX_P6 6 ASP A 43 ? PHE A 57 ? ASP A 43 PHE A 57 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A ASN 33 ? ? HD22 A ASN 36 ? ? 1.23 2 10 O A LYS 7 ? ? H A GLU 10 ? ? 1.57 3 19 H A ASN 33 ? ? HD22 A ASN 36 ? ? 1.26 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 9 ? ? -59.30 -6.98 2 1 PRO A 12 ? ? -45.20 -15.29 3 1 ASN A 33 ? ? 170.80 151.33 4 1 PRO A 34 ? ? -45.83 -7.91 5 1 MET A 38 ? ? -59.51 -9.21 6 1 MET A 60 ? ? 53.29 98.03 7 2 PRO A 12 ? ? -45.76 -15.42 8 2 ASN A 33 ? ? 171.11 161.22 9 2 PRO A 34 ? ? -45.94 -10.07 10 2 MET A 60 ? ? -168.61 -61.61 11 3 MET A 9 ? ? -57.22 -7.04 12 3 PRO A 12 ? ? -45.82 -13.06 13 3 ASN A 33 ? ? 170.96 152.21 14 3 PRO A 34 ? ? -47.64 -8.22 15 3 PHE A 57 ? ? -154.24 88.42 16 3 PRO A 58 ? ? -92.74 52.67 17 3 MET A 60 ? ? -134.98 -83.24 18 4 PRO A 12 ? ? -45.94 -12.53 19 4 ASN A 33 ? ? 174.13 157.86 20 4 PRO A 34 ? ? -45.54 -9.74 21 4 MET A 38 ? ? -72.11 24.76 22 4 LYS A 39 ? ? -146.46 -38.43 23 4 MET A 60 ? ? 52.75 96.54 24 5 MET A 9 ? ? -58.06 -7.16 25 5 PRO A 12 ? ? -44.53 -15.42 26 5 ASN A 33 ? ? 175.57 164.08 27 5 PRO A 34 ? ? -45.69 -9.94 28 5 MET A 38 ? ? -65.23 21.40 29 5 LYS A 39 ? ? -154.25 -34.10 30 5 PRO A 58 ? ? -63.69 10.30 31 5 THR A 61 ? ? 52.44 76.13 32 6 MET A 9 ? ? -57.43 -6.80 33 6 PRO A 12 ? ? -45.99 -13.44 34 6 ASN A 33 ? ? 172.01 156.41 35 6 PRO A 34 ? ? -45.85 -9.40 36 6 PRO A 58 ? ? -63.08 -78.00 37 6 MET A 60 ? ? 53.85 96.93 38 6 THR A 61 ? ? -65.14 -160.28 39 7 MET A 9 ? ? -57.14 -7.30 40 7 PRO A 12 ? ? -46.19 -12.91 41 7 ASN A 33 ? ? 174.89 157.58 42 7 PRO A 34 ? ? -48.63 -8.54 43 7 PRO A 58 ? ? -42.14 90.25 44 7 MET A 60 ? ? -175.60 114.80 45 8 MET A 9 ? ? -58.53 -6.95 46 8 ASN A 11 ? ? -160.34 90.70 47 8 PRO A 12 ? ? -45.37 -14.22 48 8 ASN A 33 ? ? 173.75 158.04 49 8 PRO A 34 ? ? -45.66 -9.54 50 8 MET A 60 ? ? 50.80 94.34 51 8 THR A 61 ? ? -62.18 94.32 52 9 PRO A 12 ? ? -44.66 -17.77 53 9 ASN A 33 ? ? 173.12 161.91 54 9 PRO A 34 ? ? -46.40 -9.80 55 9 MET A 38 ? ? -51.13 -9.92 56 9 PRO A 58 ? ? -51.31 -9.76 57 9 MET A 60 ? ? -174.03 85.20 58 9 THR A 61 ? ? -69.27 69.73 59 10 PRO A 12 ? ? -46.22 -11.15 60 10 ASN A 33 ? ? 174.18 161.80 61 10 PRO A 34 ? ? -45.91 -10.04 62 10 MET A 60 ? ? 52.67 77.17 63 11 ASN A 11 ? ? -160.24 92.06 64 11 PRO A 12 ? ? -46.63 -12.34 65 11 ASN A 33 ? ? 171.72 161.71 66 11 PRO A 34 ? ? -45.89 -10.00 67 11 MET A 38 ? ? -69.00 5.25 68 11 PRO A 58 ? ? -42.27 102.45 69 11 MET A 60 ? ? 50.70 -167.75 70 12 MET A 9 ? ? -56.94 -7.22 71 12 PRO A 12 ? ? -45.99 -12.93 72 12 ASN A 33 ? ? 173.77 157.71 73 12 PRO A 34 ? ? -45.56 -9.53 74 12 MET A 38 ? ? -67.23 20.05 75 12 LYS A 39 ? ? -145.57 -39.48 76 12 PRO A 58 ? ? -66.29 10.72 77 12 MET A 60 ? ? -67.04 96.21 78 12 THR A 61 ? ? -164.50 -72.37 79 13 GLU A 10 ? ? -54.78 -9.90 80 13 PRO A 12 ? ? -44.93 -16.68 81 13 ASN A 33 ? ? 174.73 157.52 82 13 PRO A 34 ? ? -49.02 -8.34 83 13 PHE A 57 ? ? -161.95 89.49 84 13 PRO A 58 ? ? -48.62 94.01 85 13 THR A 61 ? ? -59.13 -84.30 86 14 MET A 9 ? ? -58.64 -6.73 87 14 PRO A 12 ? ? -45.26 -14.59 88 14 ASN A 33 ? ? 175.20 161.65 89 14 PRO A 34 ? ? -52.99 -8.22 90 14 MET A 60 ? ? 52.71 -154.08 91 14 THR A 61 ? ? -164.69 86.84 92 15 MET A 9 ? ? -58.07 -6.84 93 15 PRO A 12 ? ? -44.81 -15.09 94 15 ASN A 33 ? ? 175.42 158.03 95 15 PRO A 34 ? ? -48.44 -8.73 96 15 MET A 38 ? ? -68.73 26.15 97 15 LYS A 39 ? ? -151.51 -36.91 98 15 ASP A 43 ? ? -68.17 93.97 99 15 MET A 60 ? ? 52.61 93.84 100 15 THR A 61 ? ? -59.12 94.38 101 16 MET A 9 ? ? -57.09 -7.11 102 16 PRO A 12 ? ? -45.62 -13.38 103 16 ASN A 33 ? ? 172.26 162.87 104 16 PRO A 34 ? ? -46.14 -9.72 105 16 MET A 38 ? ? -55.33 -5.89 106 16 PRO A 58 ? ? -68.24 20.46 107 17 ASN A 33 ? ? 174.90 161.93 108 17 PRO A 34 ? ? -52.04 -7.97 109 17 MET A 60 ? ? 52.54 95.89 110 18 MET A 9 ? ? -55.80 -7.11 111 18 PRO A 12 ? ? -46.48 -13.34 112 18 ASN A 33 ? ? 173.89 161.67 113 18 PRO A 34 ? ? -50.08 -8.69 114 18 MET A 38 ? ? -67.94 25.29 115 18 LYS A 39 ? ? -152.00 -37.55 116 18 ASP A 43 ? ? -67.30 95.00 117 18 PRO A 58 ? ? -67.29 19.92 118 18 MET A 60 ? ? -65.30 90.97 119 18 THR A 61 ? ? -69.25 -75.48 120 19 PRO A 12 ? ? -46.58 -11.14 121 19 ASN A 33 ? ? 174.39 154.30 122 19 PRO A 34 ? ? -52.43 -6.02 123 19 PRO A 58 ? ? -71.56 26.32 124 19 THR A 61 ? ? -59.33 -177.46 125 20 MET A 9 ? ? -57.05 -6.85 126 20 PRO A 12 ? ? -46.23 -14.11 127 20 ASN A 33 ? ? 173.88 157.81 128 20 PRO A 34 ? ? -45.48 -9.63 129 20 MET A 38 ? ? -60.50 1.41 130 20 PRO A 58 ? ? -67.07 26.10 131 20 MET A 60 ? ? 52.97 96.82 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LNM _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LNM _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '20 mM potassium phosphate-1, 20 mM sodium citrate-2, 100 mM sodium chloride-3, 10 % [U-99% 2H] TFE-4, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'potassium phosphate-1' 20 ? mM ? 1 'sodium citrate-2' 20 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 TFE-4 10 ? % '[U-99% 2H]' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 140 _pdbx_nmr_exptl_sample_conditions.pH 5.56 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HNCO' 1 6 1 '3D HN(CA)CO' 1 7 1 '3D HNCA' 1 8 1 '3D HN(CO)CA' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D CCCONH' 1 11 1 '3D 1H-15N NOESY' 1 12 1 '3D 1H-15N TOCSY' 1 13 1 '3D 1H-13C NOESY' 1 14 1 '2D 1H-1H NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LNM _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 839 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 158 _pdbx_nmr_constraints.NOE_long_range_total_count 85 _pdbx_nmr_constraints.NOE_medium_range_total_count 309 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 257 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2LNM _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 1 2.18 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView 2 5 'Johnson, One Moon Scientific' 'peak picking' NMRView 3 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 4 ? 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS 5 ? ? refinement 'X-PLOR NIH' 6 ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PHE N N N N 226 PHE CA C N S 227 PHE C C N N 228 PHE O O N N 229 PHE CB C N N 230 PHE CG C Y N 231 PHE CD1 C Y N 232 PHE CD2 C Y N 233 PHE CE1 C Y N 234 PHE CE2 C Y N 235 PHE CZ C Y N 236 PHE OXT O N N 237 PHE H H N N 238 PHE H2 H N N 239 PHE HA H N N 240 PHE HB2 H N N 241 PHE HB3 H N N 242 PHE HD1 H N N 243 PHE HD2 H N N 244 PHE HE1 H N N 245 PHE HE2 H N N 246 PHE HZ H N N 247 PHE HXT H N N 248 PRO N N N N 249 PRO CA C N S 250 PRO C C N N 251 PRO O O N N 252 PRO CB C N N 253 PRO CG C N N 254 PRO CD C N N 255 PRO OXT O N N 256 PRO H H N N 257 PRO HA H N N 258 PRO HB2 H N N 259 PRO HB3 H N N 260 PRO HG2 H N N 261 PRO HG3 H N N 262 PRO HD2 H N N 263 PRO HD3 H N N 264 PRO HXT H N N 265 SER N N N N 266 SER CA C N S 267 SER C C N N 268 SER O O N N 269 SER CB C N N 270 SER OG O N N 271 SER OXT O N N 272 SER H H N N 273 SER H2 H N N 274 SER HA H N N 275 SER HB2 H N N 276 SER HB3 H N N 277 SER HG H N N 278 SER HXT H N N 279 THR N N N N 280 THR CA C N S 281 THR C C N N 282 THR O O N N 283 THR CB C N R 284 THR OG1 O N N 285 THR CG2 C N N 286 THR OXT O N N 287 THR H H N N 288 THR H2 H N N 289 THR HA H N N 290 THR HB H N N 291 THR HG1 H N N 292 THR HG21 H N N 293 THR HG22 H N N 294 THR HG23 H N N 295 THR HXT H N N 296 TYR N N N N 297 TYR CA C N S 298 TYR C C N N 299 TYR O O N N 300 TYR CB C N N 301 TYR CG C Y N 302 TYR CD1 C Y N 303 TYR CD2 C Y N 304 TYR CE1 C Y N 305 TYR CE2 C Y N 306 TYR CZ C Y N 307 TYR OH O N N 308 TYR OXT O N N 309 TYR H H N N 310 TYR H2 H N N 311 TYR HA H N N 312 TYR HB2 H N N 313 TYR HB3 H N N 314 TYR HD1 H N N 315 TYR HD2 H N N 316 TYR HE1 H N N 317 TYR HE2 H N N 318 TYR HH H N N 319 TYR HXT H N N 320 VAL N N N N 321 VAL CA C N S 322 VAL C C N N 323 VAL O O N N 324 VAL CB C N N 325 VAL CG1 C N N 326 VAL CG2 C N N 327 VAL OXT O N N 328 VAL H H N N 329 VAL H2 H N N 330 VAL HA H N N 331 VAL HB H N N 332 VAL HG11 H N N 333 VAL HG12 H N N 334 VAL HG13 H N N 335 VAL HG21 H N N 336 VAL HG22 H N N 337 VAL HG23 H N N 338 VAL HXT H N N 339 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TYR N CA sing N N 283 TYR N H sing N N 284 TYR N H2 sing N N 285 TYR CA C sing N N 286 TYR CA CB sing N N 287 TYR CA HA sing N N 288 TYR C O doub N N 289 TYR C OXT sing N N 290 TYR CB CG sing N N 291 TYR CB HB2 sing N N 292 TYR CB HB3 sing N N 293 TYR CG CD1 doub Y N 294 TYR CG CD2 sing Y N 295 TYR CD1 CE1 sing Y N 296 TYR CD1 HD1 sing N N 297 TYR CD2 CE2 doub Y N 298 TYR CD2 HD2 sing N N 299 TYR CE1 CZ doub Y N 300 TYR CE1 HE1 sing N N 301 TYR CE2 CZ sing Y N 302 TYR CE2 HE2 sing N N 303 TYR CZ OH sing N N 304 TYR OH HH sing N N 305 TYR OXT HXT sing N N 306 VAL N CA sing N N 307 VAL N H sing N N 308 VAL N H2 sing N N 309 VAL CA C sing N N 310 VAL CA CB sing N N 311 VAL CA HA sing N N 312 VAL C O doub N N 313 VAL C OXT sing N N 314 VAL CB CG1 sing N N 315 VAL CB CG2 sing N N 316 VAL CB HB sing N N 317 VAL CG1 HG11 sing N N 318 VAL CG1 HG12 sing N N 319 VAL CG1 HG13 sing N N 320 VAL CG2 HG21 sing N N 321 VAL CG2 HG22 sing N N 322 VAL CG2 HG23 sing N N 323 VAL OXT HXT sing N N 324 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2LNM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_