data_2LO1 # _entry.id 2LO1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LO1 pdb_00002lo1 10.2210/pdb2lo1/pdb RCSB RCSB102619 ? ? BMRB 18190 ? ? WWPDB D_1000102619 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18190 BMRB unspecified . JCSG-421429 TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LO1 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-01-09 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dutta, S.K.' 1 'Serrano, P.' 2 'Geralt, M.' 3 'Wuthrich, K.' 4 'Joint Center for Structural Genomics (JCSG)' 5 'Partnership for Stem Cell Biology (STEMCELL)' 6 # _citation.id primary _citation.title 'NMR structure of the protein BC008182, DNAJ homolog from Homo sapiens' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dutta, S.K.' 1 ? primary 'Serrano, P.' 2 ? primary 'Geralt, M.' 3 ? primary 'Wuthrich, K.' 4 ? primary 'Joint Center for Structural Genomics (JCSG)' 5 ? primary 'Partnership for Stem Cell Biology (STEMCELL)' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DnaJ homolog subfamily A member 1' _entity.formula_weight 8224.290 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'J domain residues 1-70' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DnaJ protein homolog 2, HSDJ, Heat shock 40 kDa protein 4, Heat shock protein J2, HSJ-2, Human DnaJ protein 2, hDj-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GMVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQ _entity_poly.pdbx_seq_one_letter_code_can GMVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier JCSG-421429 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 VAL n 1 4 LYS n 1 5 GLU n 1 6 THR n 1 7 THR n 1 8 TYR n 1 9 TYR n 1 10 ASP n 1 11 VAL n 1 12 LEU n 1 13 GLY n 1 14 VAL n 1 15 LYS n 1 16 PRO n 1 17 ASN n 1 18 ALA n 1 19 THR n 1 20 GLN n 1 21 GLU n 1 22 GLU n 1 23 LEU n 1 24 LYS n 1 25 LYS n 1 26 ALA n 1 27 TYR n 1 28 ARG n 1 29 LYS n 1 30 LEU n 1 31 ALA n 1 32 LEU n 1 33 LYS n 1 34 TYR n 1 35 HIS n 1 36 PRO n 1 37 ASP n 1 38 LYS n 1 39 ASN n 1 40 PRO n 1 41 ASN n 1 42 GLU n 1 43 GLY n 1 44 GLU n 1 45 LYS n 1 46 PHE n 1 47 LYS n 1 48 GLN n 1 49 ILE n 1 50 SER n 1 51 GLN n 1 52 ALA n 1 53 TYR n 1 54 GLU n 1 55 VAL n 1 56 LEU n 1 57 SER n 1 58 ASP n 1 59 ALA n 1 60 LYS n 1 61 LYS n 1 62 ARG n 1 63 GLU n 1 64 LEU n 1 65 TYR n 1 66 ASP n 1 67 LYS n 1 68 GLY n 1 69 GLY n 1 70 GLU n 1 71 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DNAJA1, DNAJ2, HDJ2, HSJ2, HSPF4' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pSpeedet _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DNJA1_HUMAN _struct_ref.pdbx_db_accession P31689 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQ _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LO1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 71 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P31689 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 71 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2LO1 _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P31689 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '4D HACANH APSY' 1 3 1 '5D HACACONH APSY' 1 4 1 '5D CBCACONH APSY' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '3D 1H-13C NOESY aliphatic' 1 7 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.080 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;1.2 mM [U-98% 13C; U-98% 15N] protein, 20 mM sodium phosphate, 5 mM sodium azide, 50 mM sodium chloride, 95 % H2O, 5 % D2O, 95% H2O/5% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LO1 _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 80 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LO1 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LO1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert P.' 'structure solution' CYANA 3.0 1 Bruker collection TopSpin 2.1 2 Bruker processing TopSpin 2.1 3 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 4 'Keller and Wuthrich' 'data analysis' CARA ? 5 'Luginbuhl, Guntert, Billeter and Wuthrich' refinement OPAL ? 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LO1 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LO1 _struct.title 'NMR structure of the protein BC008182, a DNAJ-like domain from Homo sapiens' _struct.pdbx_model_details 'closest to the average, model 9' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LO1 _struct_keywords.pdbx_keywords CHAPERONE _struct_keywords.text 'CHAPERONE, PSI-Biology, Joint Center for Structural Genomics, JCSG, Partnership for Stem Cell Biology, STEMCELL' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 7 ? LEU A 12 ? THR A 7 LEU A 12 1 ? 6 HELX_P HELX_P2 2 THR A 19 ? HIS A 35 ? THR A 19 HIS A 35 1 ? 17 HELX_P HELX_P3 3 PRO A 36 ? ASN A 39 ? PRO A 36 ASN A 39 5 ? 4 HELX_P HELX_P4 4 GLU A 42 ? LEU A 56 ? GLU A 42 LEU A 56 1 ? 15 HELX_P HELX_P5 5 ASP A 58 ? ASP A 66 ? ASP A 58 ASP A 66 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2LO1 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 GLN 71 71 71 GLN GLN A . n # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Joint Center for Structural Genomics' 1 JCSG PSI:Biology 'Partnership for Stem Cell Biology' 2 STEMCELL PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-02-15 2 'Structure model' 1 1 2015-10-21 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1.2 ? mM '[U-98% 13C; U-98% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium azide-3' 5 ? mM ? 1 'sodium chloride-4' 50 ? mM ? 1 H2O-5 95 ? % ? 1 D2O-6 5 ? % ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LO1 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1317 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 361 _pdbx_nmr_constraints.NOE_long_range_total_count 269 _pdbx_nmr_constraints.NOE_medium_range_total_count 339 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 348 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 16 ? ? -57.61 5.74 2 1 LEU A 23 ? ? -53.91 -73.41 3 1 ASN A 39 ? ? -166.14 71.30 4 2 MET A 2 ? ? -89.77 42.78 5 2 VAL A 3 ? ? -69.79 81.12 6 2 PRO A 16 ? ? -66.54 6.05 7 2 TYR A 34 ? ? -77.72 22.20 8 3 LYS A 4 ? ? -141.05 16.08 9 3 ASN A 17 ? ? -82.63 37.06 10 3 ASN A 39 ? ? -145.60 58.86 11 4 MET A 2 ? ? -76.45 34.49 12 4 TYR A 8 ? ? -62.24 0.35 13 4 ASN A 39 ? ? -154.31 60.52 14 5 GLU A 5 ? ? -154.22 32.99 15 5 PRO A 16 ? ? -67.49 3.05 16 5 ASN A 39 ? ? -154.96 59.03 17 5 LYS A 67 ? ? -146.16 22.93 18 5 GLU A 70 ? ? -159.04 26.51 19 6 LYS A 4 ? ? -91.09 59.90 20 6 LYS A 33 ? ? -98.14 -72.05 21 6 TYR A 34 ? ? -79.12 29.53 22 6 ASN A 39 ? ? -151.75 66.45 23 7 TYR A 9 ? ? -147.12 -58.33 24 7 ASN A 39 ? ? -163.50 62.32 25 7 GLU A 70 ? ? -167.32 37.64 26 8 LYS A 4 ? ? -145.73 27.43 27 8 ASN A 39 ? ? -151.43 72.40 28 9 MET A 2 ? ? -145.21 39.47 29 9 LYS A 4 ? ? -110.35 51.42 30 9 GLU A 5 ? ? -148.45 23.53 31 9 PRO A 16 ? ? -68.77 5.42 32 9 ASN A 39 ? ? -151.83 70.25 33 9 LYS A 67 ? ? -149.11 52.29 34 9 GLU A 70 ? ? -143.54 53.12 35 10 MET A 2 ? ? -140.65 21.13 36 10 VAL A 3 ? ? -68.46 86.85 37 10 LYS A 4 ? ? -104.19 48.99 38 10 THR A 7 ? ? -58.73 172.58 39 10 ASN A 39 ? ? -161.76 58.62 40 10 GLU A 70 ? ? -144.15 19.37 41 11 MET A 2 ? ? -155.28 13.44 42 11 ASN A 17 ? ? -92.30 35.16 43 11 ASN A 39 ? ? -165.18 60.16 44 12 MET A 2 ? ? -155.41 15.60 45 12 ASN A 39 ? ? -159.27 66.84 46 13 ASN A 39 ? ? -151.69 65.59 47 13 GLU A 70 ? ? -156.23 33.21 48 14 PRO A 16 ? ? -66.51 5.72 49 14 LYS A 33 ? ? -100.55 -61.25 50 15 TYR A 34 ? ? -90.84 52.76 51 15 ASN A 39 ? ? -154.17 55.25 52 15 GLU A 70 ? ? -152.42 66.86 53 16 MET A 2 ? ? -140.52 14.06 54 16 PRO A 16 ? ? -64.40 4.24 55 16 ASN A 39 ? ? -152.19 61.37 56 16 ASN A 41 ? ? -56.18 -2.17 57 16 GLU A 70 ? ? -152.99 4.40 58 17 LYS A 4 ? ? -140.02 21.41 59 17 ASN A 17 ? ? -82.69 42.33 60 17 ASN A 39 ? ? -150.44 59.35 61 18 TYR A 8 ? ? -61.73 21.12 62 18 PRO A 16 ? ? -66.05 1.51 63 18 ASN A 17 ? ? -105.11 46.19 64 18 ASN A 39 ? ? -161.39 74.86 65 18 GLU A 70 ? ? -89.15 33.43 66 19 MET A 2 ? ? -152.49 9.69 67 19 TYR A 9 ? ? -143.15 -53.97 68 19 ASN A 17 ? ? -107.91 43.40 69 19 ASN A 39 ? ? -153.85 61.03 70 19 GLU A 70 ? ? -147.25 13.47 71 20 LYS A 4 ? ? -154.02 34.24 72 20 ASN A 39 ? ? -160.93 72.61 73 20 LYS A 67 ? ? -140.28 49.32 74 20 GLU A 70 ? ? -153.11 10.56 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 TYR A 9 ? ? 0.084 'SIDE CHAIN' 2 4 ARG A 62 ? ? 0.076 'SIDE CHAIN' 3 6 TYR A 34 ? ? 0.081 'SIDE CHAIN' 4 8 ARG A 62 ? ? 0.076 'SIDE CHAIN' 5 10 TYR A 34 ? ? 0.080 'SIDE CHAIN' 6 11 ARG A 62 ? ? 0.113 'SIDE CHAIN' 7 12 TYR A 27 ? ? 0.072 'SIDE CHAIN' 8 12 TYR A 53 ? ? 0.069 'SIDE CHAIN' 9 14 TYR A 9 ? ? 0.067 'SIDE CHAIN' 10 15 TYR A 27 ? ? 0.085 'SIDE CHAIN' 11 16 ARG A 28 ? ? 0.109 'SIDE CHAIN' 12 19 ARG A 62 ? ? 0.109 'SIDE CHAIN' #