data_2LOH # _entry.id 2LOH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LOH pdb_00002loh 10.2210/pdb2loh/pdb RCSB RCSB102635 ? ? BMRB 18080 ? 10.13018/BMR18080 WWPDB D_1000102635 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-05-23 2 'Structure model' 1 1 2012-07-11 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_ref_seq_dif.details' 7 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LOH _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-01-24 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2LLM PDB . unspecified 18080 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nadezhdin, K.' 1 'Bocharov, E.' 2 'Bocharova, O.' 3 'Arseniev, A.' 4 # _citation.id primary _citation.title 'Dimeric structure of transmembrane domain of amyloid precursor protein in micellar environment.' _citation.journal_abbrev 'Febs Lett.' _citation.journal_volume 586 _citation.page_first 1687 _citation.page_last 1692 _citation.year 2012 _citation.journal_id_ASTM FEBLAL _citation.country NE _citation.journal_id_ISSN 0014-5793 _citation.journal_id_CSD 0165 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22584060 _citation.pdbx_database_id_DOI 10.1016/j.febslet.2012.04.062 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nadezhdin, K.D.' 1 ? primary 'Bocharova, O.V.' 2 ? primary 'Bocharov, E.V.' 3 ? primary 'Arseniev, A.S.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'P3(42)' _entity.formula_weight 4450.460 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 686-726' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Amyloid beta A4 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK _entity_poly.pdbx_seq_one_letter_code_can GSQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLN n 1 4 LYS n 1 5 LEU n 1 6 VAL n 1 7 PHE n 1 8 PHE n 1 9 ALA n 1 10 GLU n 1 11 ASP n 1 12 VAL n 1 13 GLY n 1 14 SER n 1 15 ASN n 1 16 LYS n 1 17 GLY n 1 18 ALA n 1 19 ILE n 1 20 ILE n 1 21 GLY n 1 22 LEU n 1 23 MET n 1 24 VAL n 1 25 GLY n 1 26 GLY n 1 27 VAL n 1 28 VAL n 1 29 ILE n 1 30 ALA n 1 31 THR n 1 32 VAL n 1 33 ILE n 1 34 VAL n 1 35 ILE n 1 36 THR n 1 37 LEU n 1 38 VAL n 1 39 MET n 1 40 LEU n 1 41 LYS n 1 42 LYS n 1 43 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'APP, A4, AD1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pGEMEX-1 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 LYS 43 43 43 LYS LYS A . n B 1 1 GLY 1 1 1 GLY GLY B . n B 1 2 SER 2 2 2 SER SER B . n B 1 3 GLN 3 3 3 GLN GLN B . n B 1 4 LYS 4 4 4 LYS LYS B . n B 1 5 LEU 5 5 5 LEU LEU B . n B 1 6 VAL 6 6 6 VAL VAL B . n B 1 7 PHE 7 7 7 PHE PHE B . n B 1 8 PHE 8 8 8 PHE PHE B . n B 1 9 ALA 9 9 9 ALA ALA B . n B 1 10 GLU 10 10 10 GLU GLU B . n B 1 11 ASP 11 11 11 ASP ASP B . n B 1 12 VAL 12 12 12 VAL VAL B . n B 1 13 GLY 13 13 13 GLY GLY B . n B 1 14 SER 14 14 14 SER SER B . n B 1 15 ASN 15 15 15 ASN ASN B . n B 1 16 LYS 16 16 16 LYS LYS B . n B 1 17 GLY 17 17 17 GLY GLY B . n B 1 18 ALA 18 18 18 ALA ALA B . n B 1 19 ILE 19 19 19 ILE ILE B . n B 1 20 ILE 20 20 20 ILE ILE B . n B 1 21 GLY 21 21 21 GLY GLY B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 MET 23 23 23 MET MET B . n B 1 24 VAL 24 24 24 VAL VAL B . n B 1 25 GLY 25 25 25 GLY GLY B . n B 1 26 GLY 26 26 26 GLY GLY B . n B 1 27 VAL 27 27 27 VAL VAL B . n B 1 28 VAL 28 28 28 VAL VAL B . n B 1 29 ILE 29 29 29 ILE ILE B . n B 1 30 ALA 30 30 30 ALA ALA B . n B 1 31 THR 31 31 31 THR THR B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 ILE 33 33 33 ILE ILE B . n B 1 34 VAL 34 34 34 VAL VAL B . n B 1 35 ILE 35 35 35 ILE ILE B . n B 1 36 THR 36 36 36 THR THR B . n B 1 37 LEU 37 37 37 LEU LEU B . n B 1 38 VAL 38 38 38 VAL VAL B . n B 1 39 MET 39 39 39 MET MET B . n B 1 40 LEU 40 40 40 LEU LEU B . n B 1 41 LYS 41 41 41 LYS LYS B . n B 1 42 LYS 42 42 42 LYS LYS B . n B 1 43 LYS 43 43 43 LYS LYS B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LOH _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LOH _struct.title 'Dimeric structure of transmembrane domain of amyloid precursor protein in micellar environment' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LOH _struct_keywords.pdbx_keywords NEUROPEPTIDE _struct_keywords.text NEUROPEPTIDE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A4_HUMAN _struct_ref.pdbx_db_accession P05067 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK _struct_ref.pdbx_align_begin 686 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LOH A 3 ? 43 ? P05067 686 ? 726 ? 3 43 2 1 2LOH B 3 ? 43 ? P05067 686 ? 726 ? 3 43 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LOH GLY A 1 ? UNP P05067 ? ? 'expression tag' 1 1 1 2LOH SER A 2 ? UNP P05067 ? ? 'expression tag' 2 2 2 2LOH GLY B 1 ? UNP P05067 ? ? 'expression tag' 1 3 2 2LOH SER B 2 ? UNP P05067 ? ? 'expression tag' 2 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 2 ? VAL A 12 ? SER A 2 VAL A 12 1 ? 11 HELX_P HELX_P2 2 ASN A 15 ? LYS A 43 ? ASN A 15 LYS A 43 1 ? 29 HELX_P HELX_P3 3 SER B 2 ? VAL B 12 ? SER B 2 VAL B 12 1 ? 11 HELX_P HELX_P4 4 ASN B 15 ? LYS B 43 ? ASN B 15 LYS B 43 1 ? 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -139.61 -74.33 2 1 VAL A 12 ? ? -99.58 -66.09 3 1 SER B 2 ? ? -139.59 -74.13 4 1 VAL B 12 ? ? -96.73 -70.39 5 2 VAL A 12 ? ? -93.56 -65.10 6 2 VAL B 12 ? ? -93.10 -65.14 7 4 SER A 2 ? ? -151.10 -44.09 8 4 LYS A 42 ? ? -173.32 135.63 9 4 SER B 2 ? ? -151.10 -44.21 10 4 LYS B 42 ? ? -173.19 135.49 11 5 ASN A 15 ? ? 63.51 105.93 12 5 ASN B 15 ? ? 63.52 104.30 13 8 VAL B 12 ? ? -67.93 -71.63 14 9 LYS A 42 ? ? 174.21 146.60 15 9 LYS B 42 ? ? 68.99 146.81 16 10 SER A 2 ? ? 52.21 72.12 17 10 LYS A 42 ? ? -174.59 -169.64 18 10 SER B 2 ? ? 52.17 72.20 19 10 MET B 39 ? ? -83.62 -75.31 20 10 LEU B 40 ? ? -175.82 -66.89 21 10 LYS B 42 ? ? -179.34 -169.85 22 11 LYS A 42 ? ? -103.40 68.99 23 11 PHE B 7 ? ? 49.29 28.57 24 11 LYS B 42 ? ? -103.45 69.11 25 12 VAL A 12 ? ? -100.38 -69.17 26 12 ASN A 15 ? ? 58.70 179.01 27 12 LYS A 42 ? ? 59.68 84.40 28 12 PHE B 7 ? ? 49.44 28.66 29 12 VAL B 12 ? ? -100.39 -69.46 30 12 ASN B 15 ? ? 58.83 179.02 31 12 LYS B 42 ? ? 59.56 84.34 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 12 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LOH _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LOH _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.9 mM [U-100% 15N] APPjmtm, 36 mM DPC, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '0.75 mM [U-100% 13C; U-100% 15N] APPjmtm, 0.75 mM APPjmtm, 60 mM [U-98% 2H] DPC, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id APPjmtm-1 0.9 ? mM '[U-100% 15N]' 1 DPC-2 36 ? mM ? 1 APPjmtm-3 0.75 ? mM '[U-100% 13C; U-100% 15N]' 2 APPjmtm-4 0.75 ? mM ? 2 DPC-5 60 ? mM '[U-98% 2H]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.pH 6.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 318 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-15N NOESY' 1 3 2 '2D 1H-15N HSQC' 1 4 2 '3D HNCO' 1 5 2 '3D HN(CO)CA' 1 6 2 '3D 1H-13C NOESY aliphatic' 1 7 2 '3D HNCA' 1 8 2 '3D HCCH-TOCSY' 1 9 2 '3D 15N,13C-F1-filtered/F3-edited NOESY' 1 10 2 '2D 1H-13C HSQC' # _pdbx_nmr_refine.entry_id 2LOH _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Keller,Bettendorff,Damberger 'peak picking' CARA 1.8.4 1 Keller,Bettendorff,Damberger 'chemical shift assignment' CARA 1.8.4 2 Keller,Bettendorff,Damberger 'peak integration' CARA 1.8.4 3 'Bruker Biospin' collection TopSpin ? 4 'Bruker Biospin' processing TopSpin ? 5 'Bruker Biospin' 'data analysis' TopSpin ? 6 'Peter Guentert' 'structure solution' CYANA 3.0 7 'Peter Guentert' processing CYANA 3.0 8 'Koradi, Billeter and Wuthrich' 'geometry optimization' MOLMOL ? 9 'Koradi, Billeter and Wuthrich' visualization MOLMOL ? 10 'Cornilescu, Delaglio and Bax' 'dihedral angles prediction' TALOS ? 11 'Peter Guentert' refinement CYANA ? 12 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 ILE N N N N 96 ILE CA C N S 97 ILE C C N N 98 ILE O O N N 99 ILE CB C N S 100 ILE CG1 C N N 101 ILE CG2 C N N 102 ILE CD1 C N N 103 ILE OXT O N N 104 ILE H H N N 105 ILE H2 H N N 106 ILE HA H N N 107 ILE HB H N N 108 ILE HG12 H N N 109 ILE HG13 H N N 110 ILE HG21 H N N 111 ILE HG22 H N N 112 ILE HG23 H N N 113 ILE HD11 H N N 114 ILE HD12 H N N 115 ILE HD13 H N N 116 ILE HXT H N N 117 LEU N N N N 118 LEU CA C N S 119 LEU C C N N 120 LEU O O N N 121 LEU CB C N N 122 LEU CG C N N 123 LEU CD1 C N N 124 LEU CD2 C N N 125 LEU OXT O N N 126 LEU H H N N 127 LEU H2 H N N 128 LEU HA H N N 129 LEU HB2 H N N 130 LEU HB3 H N N 131 LEU HG H N N 132 LEU HD11 H N N 133 LEU HD12 H N N 134 LEU HD13 H N N 135 LEU HD21 H N N 136 LEU HD22 H N N 137 LEU HD23 H N N 138 LEU HXT H N N 139 LYS N N N N 140 LYS CA C N S 141 LYS C C N N 142 LYS O O N N 143 LYS CB C N N 144 LYS CG C N N 145 LYS CD C N N 146 LYS CE C N N 147 LYS NZ N N N 148 LYS OXT O N N 149 LYS H H N N 150 LYS H2 H N N 151 LYS HA H N N 152 LYS HB2 H N N 153 LYS HB3 H N N 154 LYS HG2 H N N 155 LYS HG3 H N N 156 LYS HD2 H N N 157 LYS HD3 H N N 158 LYS HE2 H N N 159 LYS HE3 H N N 160 LYS HZ1 H N N 161 LYS HZ2 H N N 162 LYS HZ3 H N N 163 LYS HXT H N N 164 MET N N N N 165 MET CA C N S 166 MET C C N N 167 MET O O N N 168 MET CB C N N 169 MET CG C N N 170 MET SD S N N 171 MET CE C N N 172 MET OXT O N N 173 MET H H N N 174 MET H2 H N N 175 MET HA H N N 176 MET HB2 H N N 177 MET HB3 H N N 178 MET HG2 H N N 179 MET HG3 H N N 180 MET HE1 H N N 181 MET HE2 H N N 182 MET HE3 H N N 183 MET HXT H N N 184 PHE N N N N 185 PHE CA C N S 186 PHE C C N N 187 PHE O O N N 188 PHE CB C N N 189 PHE CG C Y N 190 PHE CD1 C Y N 191 PHE CD2 C Y N 192 PHE CE1 C Y N 193 PHE CE2 C Y N 194 PHE CZ C Y N 195 PHE OXT O N N 196 PHE H H N N 197 PHE H2 H N N 198 PHE HA H N N 199 PHE HB2 H N N 200 PHE HB3 H N N 201 PHE HD1 H N N 202 PHE HD2 H N N 203 PHE HE1 H N N 204 PHE HE2 H N N 205 PHE HZ H N N 206 PHE HXT H N N 207 SER N N N N 208 SER CA C N S 209 SER C C N N 210 SER O O N N 211 SER CB C N N 212 SER OG O N N 213 SER OXT O N N 214 SER H H N N 215 SER H2 H N N 216 SER HA H N N 217 SER HB2 H N N 218 SER HB3 H N N 219 SER HG H N N 220 SER HXT H N N 221 THR N N N N 222 THR CA C N S 223 THR C C N N 224 THR O O N N 225 THR CB C N R 226 THR OG1 O N N 227 THR CG2 C N N 228 THR OXT O N N 229 THR H H N N 230 THR H2 H N N 231 THR HA H N N 232 THR HB H N N 233 THR HG1 H N N 234 THR HG21 H N N 235 THR HG22 H N N 236 THR HG23 H N N 237 THR HXT H N N 238 VAL N N N N 239 VAL CA C N S 240 VAL C C N N 241 VAL O O N N 242 VAL CB C N N 243 VAL CG1 C N N 244 VAL CG2 C N N 245 VAL OXT O N N 246 VAL H H N N 247 VAL H2 H N N 248 VAL HA H N N 249 VAL HB H N N 250 VAL HG11 H N N 251 VAL HG12 H N N 252 VAL HG13 H N N 253 VAL HG21 H N N 254 VAL HG22 H N N 255 VAL HG23 H N N 256 VAL HXT H N N 257 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 ILE N CA sing N N 90 ILE N H sing N N 91 ILE N H2 sing N N 92 ILE CA C sing N N 93 ILE CA CB sing N N 94 ILE CA HA sing N N 95 ILE C O doub N N 96 ILE C OXT sing N N 97 ILE CB CG1 sing N N 98 ILE CB CG2 sing N N 99 ILE CB HB sing N N 100 ILE CG1 CD1 sing N N 101 ILE CG1 HG12 sing N N 102 ILE CG1 HG13 sing N N 103 ILE CG2 HG21 sing N N 104 ILE CG2 HG22 sing N N 105 ILE CG2 HG23 sing N N 106 ILE CD1 HD11 sing N N 107 ILE CD1 HD12 sing N N 108 ILE CD1 HD13 sing N N 109 ILE OXT HXT sing N N 110 LEU N CA sing N N 111 LEU N H sing N N 112 LEU N H2 sing N N 113 LEU CA C sing N N 114 LEU CA CB sing N N 115 LEU CA HA sing N N 116 LEU C O doub N N 117 LEU C OXT sing N N 118 LEU CB CG sing N N 119 LEU CB HB2 sing N N 120 LEU CB HB3 sing N N 121 LEU CG CD1 sing N N 122 LEU CG CD2 sing N N 123 LEU CG HG sing N N 124 LEU CD1 HD11 sing N N 125 LEU CD1 HD12 sing N N 126 LEU CD1 HD13 sing N N 127 LEU CD2 HD21 sing N N 128 LEU CD2 HD22 sing N N 129 LEU CD2 HD23 sing N N 130 LEU OXT HXT sing N N 131 LYS N CA sing N N 132 LYS N H sing N N 133 LYS N H2 sing N N 134 LYS CA C sing N N 135 LYS CA CB sing N N 136 LYS CA HA sing N N 137 LYS C O doub N N 138 LYS C OXT sing N N 139 LYS CB CG sing N N 140 LYS CB HB2 sing N N 141 LYS CB HB3 sing N N 142 LYS CG CD sing N N 143 LYS CG HG2 sing N N 144 LYS CG HG3 sing N N 145 LYS CD CE sing N N 146 LYS CD HD2 sing N N 147 LYS CD HD3 sing N N 148 LYS CE NZ sing N N 149 LYS CE HE2 sing N N 150 LYS CE HE3 sing N N 151 LYS NZ HZ1 sing N N 152 LYS NZ HZ2 sing N N 153 LYS NZ HZ3 sing N N 154 LYS OXT HXT sing N N 155 MET N CA sing N N 156 MET N H sing N N 157 MET N H2 sing N N 158 MET CA C sing N N 159 MET CA CB sing N N 160 MET CA HA sing N N 161 MET C O doub N N 162 MET C OXT sing N N 163 MET CB CG sing N N 164 MET CB HB2 sing N N 165 MET CB HB3 sing N N 166 MET CG SD sing N N 167 MET CG HG2 sing N N 168 MET CG HG3 sing N N 169 MET SD CE sing N N 170 MET CE HE1 sing N N 171 MET CE HE2 sing N N 172 MET CE HE3 sing N N 173 MET OXT HXT sing N N 174 PHE N CA sing N N 175 PHE N H sing N N 176 PHE N H2 sing N N 177 PHE CA C sing N N 178 PHE CA CB sing N N 179 PHE CA HA sing N N 180 PHE C O doub N N 181 PHE C OXT sing N N 182 PHE CB CG sing N N 183 PHE CB HB2 sing N N 184 PHE CB HB3 sing N N 185 PHE CG CD1 doub Y N 186 PHE CG CD2 sing Y N 187 PHE CD1 CE1 sing Y N 188 PHE CD1 HD1 sing N N 189 PHE CD2 CE2 doub Y N 190 PHE CD2 HD2 sing N N 191 PHE CE1 CZ doub Y N 192 PHE CE1 HE1 sing N N 193 PHE CE2 CZ sing Y N 194 PHE CE2 HE2 sing N N 195 PHE CZ HZ sing N N 196 PHE OXT HXT sing N N 197 SER N CA sing N N 198 SER N H sing N N 199 SER N H2 sing N N 200 SER CA C sing N N 201 SER CA CB sing N N 202 SER CA HA sing N N 203 SER C O doub N N 204 SER C OXT sing N N 205 SER CB OG sing N N 206 SER CB HB2 sing N N 207 SER CB HB3 sing N N 208 SER OG HG sing N N 209 SER OXT HXT sing N N 210 THR N CA sing N N 211 THR N H sing N N 212 THR N H2 sing N N 213 THR CA C sing N N 214 THR CA CB sing N N 215 THR CA HA sing N N 216 THR C O doub N N 217 THR C OXT sing N N 218 THR CB OG1 sing N N 219 THR CB CG2 sing N N 220 THR CB HB sing N N 221 THR OG1 HG1 sing N N 222 THR CG2 HG21 sing N N 223 THR CG2 HG22 sing N N 224 THR CG2 HG23 sing N N 225 THR OXT HXT sing N N 226 VAL N CA sing N N 227 VAL N H sing N N 228 VAL N H2 sing N N 229 VAL CA C sing N N 230 VAL CA CB sing N N 231 VAL CA HA sing N N 232 VAL C O doub N N 233 VAL C OXT sing N N 234 VAL CB CG1 sing N N 235 VAL CB CG2 sing N N 236 VAL CB HB sing N N 237 VAL CG1 HG11 sing N N 238 VAL CG1 HG12 sing N N 239 VAL CG1 HG13 sing N N 240 VAL CG2 HG21 sing N N 241 VAL CG2 HG22 sing N N 242 VAL CG2 HG23 sing N N 243 VAL OXT HXT sing N N 244 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker 'AVANCE III' 1 'Bruker Avance III' 800 Bruker 'AVANCE III' 2 'Bruker Avance III' # _atom_sites.entry_id 2LOH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #