data_2LOK # _entry.id 2LOK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LOK pdb_00002lok 10.2210/pdb2lok/pdb RCSB RCSB102637 ? ? BMRB 18215 ? 10.13018/BMR18215 WWPDB D_1000102637 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-02-01 2 'Structure model' 1 1 2012-06-27 3 'Structure model' 1 2 2012-07-18 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_nmr_software 5 4 'Structure model' pdbx_nmr_spectrometer 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LOK _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-01-24 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18215 BMRB unspecified . HsR50 TargetTrack unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rossi, P.' 1 'Lange, O.F.' 2 'Lee, H.' 3 'Hamilton, K.' 4 'Ciccosanti, C.' 5 'Buchwald, W.A.' 6 'Wang, H.' 7 'Acton, T.B.' 8 'Xiao, R.' 9 'Everett, J.K.' 10 'Montelione, G.T.' 11 'Northeast Structural Genomics Consortium (NESG)' 12 # _citation.id primary _citation.title 'Determination of solution structures of proteins up to 40 kDa using CS-Rosetta with sparse NMR data from deuterated samples.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 109 _citation.page_first 10873 _citation.page_last 10878 _citation.year 2012 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22733734 _citation.pdbx_database_id_DOI 10.1073/pnas.1203013109 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lange, O.F.' 1 ? primary 'Rossi, P.' 2 ? primary 'Sgourakis, N.G.' 3 ? primary 'Song, Y.' 4 ? primary 'Lee, H.W.' 5 ? primary 'Aramini, J.M.' 6 ? primary 'Ertekin, A.' 7 ? primary 'Xiao, R.' 8 ? primary 'Acton, T.B.' 9 ? primary 'Montelione, G.T.' 10 ? primary 'Baker, D.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 21582.410 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSPIPLPVTDTDDAWRARIAAHRADKDEFLATHDQSPIPPADRGAFDGLRYFDIDASFRVAARYQPARDPEAVELETTRG PPAEYTRAAVLGFDLGDSHHTLTAFRVEGESSLFVPFTDETTDDGRTYEHGRYLDVDPAGADGGDEVALDFNLAYNPFCA YGGSFSCALPPADNHVPAAITAGERVDADLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSPIPLPVTDTDDAWRARIAAHRADKDEFLATHDQSPIPPADRGAFDGLRYFDIDASFRVAARYQPARDPEAVELETTRG PPAEYTRAAVLGFDLGDSHHTLTAFRVEGESSLFVPFTDETTDDGRTYEHGRYLDVDPAGADGGDEVALDFNLAYNPFCA YGGSFSCALPPADNHVPAAITAGERVDADLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier HsR50 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 PRO n 1 4 ILE n 1 5 PRO n 1 6 LEU n 1 7 PRO n 1 8 VAL n 1 9 THR n 1 10 ASP n 1 11 THR n 1 12 ASP n 1 13 ASP n 1 14 ALA n 1 15 TRP n 1 16 ARG n 1 17 ALA n 1 18 ARG n 1 19 ILE n 1 20 ALA n 1 21 ALA n 1 22 HIS n 1 23 ARG n 1 24 ALA n 1 25 ASP n 1 26 LYS n 1 27 ASP n 1 28 GLU n 1 29 PHE n 1 30 LEU n 1 31 ALA n 1 32 THR n 1 33 HIS n 1 34 ASP n 1 35 GLN n 1 36 SER n 1 37 PRO n 1 38 ILE n 1 39 PRO n 1 40 PRO n 1 41 ALA n 1 42 ASP n 1 43 ARG n 1 44 GLY n 1 45 ALA n 1 46 PHE n 1 47 ASP n 1 48 GLY n 1 49 LEU n 1 50 ARG n 1 51 TYR n 1 52 PHE n 1 53 ASP n 1 54 ILE n 1 55 ASP n 1 56 ALA n 1 57 SER n 1 58 PHE n 1 59 ARG n 1 60 VAL n 1 61 ALA n 1 62 ALA n 1 63 ARG n 1 64 TYR n 1 65 GLN n 1 66 PRO n 1 67 ALA n 1 68 ARG n 1 69 ASP n 1 70 PRO n 1 71 GLU n 1 72 ALA n 1 73 VAL n 1 74 GLU n 1 75 LEU n 1 76 GLU n 1 77 THR n 1 78 THR n 1 79 ARG n 1 80 GLY n 1 81 PRO n 1 82 PRO n 1 83 ALA n 1 84 GLU n 1 85 TYR n 1 86 THR n 1 87 ARG n 1 88 ALA n 1 89 ALA n 1 90 VAL n 1 91 LEU n 1 92 GLY n 1 93 PHE n 1 94 ASP n 1 95 LEU n 1 96 GLY n 1 97 ASP n 1 98 SER n 1 99 HIS n 1 100 HIS n 1 101 THR n 1 102 LEU n 1 103 THR n 1 104 ALA n 1 105 PHE n 1 106 ARG n 1 107 VAL n 1 108 GLU n 1 109 GLY n 1 110 GLU n 1 111 SER n 1 112 SER n 1 113 LEU n 1 114 PHE n 1 115 VAL n 1 116 PRO n 1 117 PHE n 1 118 THR n 1 119 ASP n 1 120 GLU n 1 121 THR n 1 122 THR n 1 123 ASP n 1 124 ASP n 1 125 GLY n 1 126 ARG n 1 127 THR n 1 128 TYR n 1 129 GLU n 1 130 HIS n 1 131 GLY n 1 132 ARG n 1 133 TYR n 1 134 LEU n 1 135 ASP n 1 136 VAL n 1 137 ASP n 1 138 PRO n 1 139 ALA n 1 140 GLY n 1 141 ALA n 1 142 ASP n 1 143 GLY n 1 144 GLY n 1 145 ASP n 1 146 GLU n 1 147 VAL n 1 148 ALA n 1 149 LEU n 1 150 ASP n 1 151 PHE n 1 152 ASN n 1 153 LEU n 1 154 ALA n 1 155 TYR n 1 156 ASN n 1 157 PRO n 1 158 PHE n 1 159 CYS n 1 160 ALA n 1 161 TYR n 1 162 GLY n 1 163 GLY n 1 164 SER n 1 165 PHE n 1 166 SER n 1 167 CYS n 1 168 ALA n 1 169 LEU n 1 170 PRO n 1 171 PRO n 1 172 ALA n 1 173 ASP n 1 174 ASN n 1 175 HIS n 1 176 VAL n 1 177 PRO n 1 178 ALA n 1 179 ALA n 1 180 ILE n 1 181 THR n 1 182 ALA n 1 183 GLY n 1 184 GLU n 1 185 ARG n 1 186 VAL n 1 187 ASP n 1 188 ALA n 1 189 ASP n 1 190 LEU n 1 191 GLU n 1 192 HIS n 1 193 HIS n 1 194 HIS n 1 195 HIS n 1 196 HIS n 1 197 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene VNG_0733H _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700922 / JCM 11081 / NRC-1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Halobacterium sp. NRC-1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 64091 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET21_NESG _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 TYR 155 155 155 TYR TYR A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 CYS 159 159 159 CYS CYS A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 CYS 167 167 167 CYS CYS A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 PRO 170 170 170 PRO PRO A . n A 1 171 PRO 171 171 171 PRO PRO A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 ASP 173 173 173 ASP ASP A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 HIS 175 175 175 HIS HIS A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 PRO 177 177 177 PRO PRO A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 ASP 189 189 189 ASP ASP A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 HIS 192 192 ? ? ? A . n A 1 193 HIS 193 193 ? ? ? A . n A 1 194 HIS 194 194 ? ? ? A . n A 1 195 HIS 195 195 ? ? ? A . n A 1 196 HIS 196 196 ? ? ? A . n A 1 197 HIS 197 197 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LOK _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LOK _struct.title ;Solution NMR Structure of the uncharacterized protein from gene locus VNG_0733H of Halobacterium salinarium, Northeast Structural Genomics Consortium Target HsR50 ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LOK _struct_keywords.pdbx_keywords 'Structural Genomics, Unknown Function' _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, PSI-Biology, Protein Structure Initiative, Unknown Function' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9HRE7_HALSA _struct_ref.pdbx_db_accession Q9HRE7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSPIPLPVTDTDDAWRARIAAHRADKDEFLATHDQSPIPPADRGAFDGLRYFDIDASFRVAARYQPARDPEAVELETTRG PPAEYTRAAVLGFDLGDSHHTLTAFRVEGESSLFVPFTDETTDDGRTYEHGRYLDVDPAGADGGDEVALDFNLAYNPFCA YGGSFSCALPPADNHVPAAITAGERVDAD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LOK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 189 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HRE7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 189 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 189 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LOK LEU A 190 ? UNP Q9HRE7 ? ? 'expression tag' 190 1 1 2LOK GLU A 191 ? UNP Q9HRE7 ? ? 'expression tag' 191 2 1 2LOK HIS A 192 ? UNP Q9HRE7 ? ? 'expression tag' 192 3 1 2LOK HIS A 193 ? UNP Q9HRE7 ? ? 'expression tag' 193 4 1 2LOK HIS A 194 ? UNP Q9HRE7 ? ? 'expression tag' 194 5 1 2LOK HIS A 195 ? UNP Q9HRE7 ? ? 'expression tag' 195 6 1 2LOK HIS A 196 ? UNP Q9HRE7 ? ? 'expression tag' 196 7 1 2LOK HIS A 197 ? UNP Q9HRE7 ? ? 'expression tag' 197 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 6 ? ASP A 10 ? LEU A 6 ASP A 10 5 ? 5 HELX_P HELX_P2 2 THR A 11 ? PHE A 29 ? THR A 11 PHE A 29 1 ? 19 HELX_P HELX_P3 3 PRO A 39 ? ALA A 45 ? PRO A 39 ALA A 45 1 ? 7 HELX_P HELX_P4 4 ASP A 119 ? ASP A 124 ? ASP A 119 ASP A 124 1 ? 6 HELX_P HELX_P5 5 PRO A 157 ? GLY A 162 ? PRO A 157 GLY A 162 5 ? 6 HELX_P HELX_P6 6 PRO A 171 ? HIS A 175 ? PRO A 171 HIS A 175 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 72 ? LEU A 75 ? ALA A 72 LEU A 75 A 2 ALA A 83 ? LEU A 95 ? ALA A 83 LEU A 95 A 3 ARG A 59 ? PRO A 66 ? ARG A 59 PRO A 66 A 4 ASP A 145 ? ASP A 150 ? ASP A 145 ASP A 150 B 1 ALA A 72 ? LEU A 75 ? ALA A 72 LEU A 75 B 2 ALA A 83 ? LEU A 95 ? ALA A 83 LEU A 95 B 3 SER A 98 ? VAL A 107 ? SER A 98 VAL A 107 B 4 GLU A 110 ? PHE A 117 ? GLU A 110 PHE A 117 B 5 ARG A 132 ? VAL A 136 ? ARG A 132 VAL A 136 B 6 ALA A 154 ? TYR A 155 ? ALA A 154 TYR A 155 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 73 ? N VAL A 73 O TYR A 85 ? O TYR A 85 A 2 3 O GLY A 92 ? O GLY A 92 N ARG A 63 ? N ARG A 63 A 3 4 N VAL A 60 ? N VAL A 60 O LEU A 149 ? O LEU A 149 B 1 2 N VAL A 73 ? N VAL A 73 O TYR A 85 ? O TYR A 85 B 2 3 N ALA A 89 ? N ALA A 89 O ALA A 104 ? O ALA A 104 B 3 4 N PHE A 105 ? N PHE A 105 O PHE A 114 ? O PHE A 114 B 4 5 N LEU A 113 ? N LEU A 113 O VAL A 136 ? O VAL A 136 B 5 6 N TYR A 133 ? N TYR A 133 O TYR A 155 ? O TYR A 155 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 16 _pdbx_validate_close_contact.auth_atom_id_1 HZ2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LYS _pdbx_validate_close_contact.auth_seq_id_1 26 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HB2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 184 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.34 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 6 ? ? -164.41 -47.75 2 1 PRO A 7 ? ? -79.82 30.42 3 1 ASP A 10 ? ? 26.70 -104.47 4 1 ALA A 67 ? ? -69.88 97.26 5 1 TYR A 128 ? ? -53.83 98.94 6 1 PRO A 157 ? ? -47.58 150.24 7 2 LEU A 6 ? ? 171.12 -49.41 8 2 PRO A 7 ? ? -77.24 21.16 9 2 ASP A 10 ? ? -37.65 153.51 10 2 ALA A 45 ? ? -99.12 30.25 11 2 ASP A 119 ? ? -161.14 -160.22 12 2 ALA A 168 ? ? -69.99 97.66 13 2 PRO A 177 ? ? -80.67 41.98 14 3 SER A 2 ? ? -159.34 -51.05 15 3 LEU A 6 ? ? -175.15 -53.23 16 3 ASP A 10 ? ? 86.08 154.30 17 3 HIS A 33 ? ? -47.42 102.60 18 3 SER A 36 ? ? -154.55 67.42 19 3 PRO A 39 ? ? -31.83 132.65 20 3 ASP A 119 ? ? -160.53 -168.35 21 3 TYR A 128 ? ? -69.64 99.54 22 3 PHE A 165 ? ? 174.23 152.69 23 3 PRO A 177 ? ? -78.61 46.00 24 3 ALA A 182 ? ? -165.39 117.74 25 4 LEU A 6 ? ? -176.36 -51.09 26 4 ASP A 10 ? ? -29.67 140.91 27 4 PRO A 177 ? ? -87.53 38.83 28 4 ALA A 182 ? ? -126.48 -157.80 29 5 LEU A 6 ? ? -177.46 -51.65 30 5 PRO A 7 ? ? -83.19 33.84 31 5 THR A 9 ? ? -91.48 39.41 32 5 ASP A 10 ? ? 48.73 -158.88 33 5 SER A 36 ? ? -154.82 71.89 34 5 PRO A 39 ? ? -39.90 134.24 35 5 TYR A 128 ? ? -37.75 96.15 36 5 ALA A 182 ? ? -164.79 116.39 37 5 ALA A 188 ? ? -67.82 5.71 38 6 LEU A 6 ? ? -178.01 -48.73 39 6 PRO A 7 ? ? -83.48 31.24 40 6 ASP A 10 ? ? -43.01 175.87 41 6 ASP A 55 ? ? -163.20 109.48 42 6 PRO A 177 ? ? -81.61 32.07 43 6 ASP A 187 ? ? -44.05 107.04 44 7 LEU A 6 ? ? 179.60 -53.28 45 7 PRO A 7 ? ? -81.12 37.35 46 7 THR A 32 ? ? -126.57 -60.08 47 7 SER A 36 ? ? -155.90 76.01 48 7 PRO A 39 ? ? -36.87 124.77 49 7 PRO A 177 ? ? -65.99 71.62 50 7 ALA A 182 ? ? -163.22 116.39 51 8 LEU A 6 ? ? -177.34 -54.94 52 8 PRO A 7 ? ? -84.52 35.98 53 8 THR A 9 ? ? 171.52 103.69 54 8 SER A 36 ? ? -157.21 68.12 55 8 ALA A 67 ? ? -66.57 98.57 56 8 TYR A 128 ? ? 33.00 54.09 57 8 ASP A 142 ? ? -129.29 -169.14 58 8 SER A 164 ? ? -105.39 68.01 59 8 ALA A 168 ? ? -68.07 99.34 60 8 ALA A 182 ? ? -161.54 115.51 61 9 LEU A 6 ? ? -177.18 -56.25 62 9 ASP A 10 ? ? -33.22 163.36 63 9 SER A 36 ? ? -157.42 77.05 64 9 ALA A 67 ? ? -68.69 95.74 65 9 LEU A 95 ? ? -166.61 117.29 66 9 PRO A 157 ? ? -48.90 153.83 67 9 SER A 164 ? ? -112.41 78.22 68 9 LEU A 190 ? ? -94.10 -60.89 69 10 LEU A 6 ? ? -161.08 -56.95 70 10 PRO A 7 ? ? -88.50 30.69 71 10 ASP A 10 ? ? -39.47 159.92 72 10 SER A 36 ? ? -157.64 79.23 73 10 ASP A 119 ? ? -160.02 -166.15 74 10 ALA A 139 ? ? 51.40 -82.75 75 10 THR A 181 ? ? -119.35 73.19 76 10 ALA A 182 ? ? -108.91 -163.05 77 10 VAL A 186 ? ? -173.20 -169.47 78 10 LEU A 190 ? ? -93.84 -66.80 79 11 LEU A 6 ? ? -167.32 -58.63 80 11 ASP A 10 ? ? -34.96 147.63 81 11 THR A 32 ? ? -120.85 -50.63 82 11 ASP A 119 ? ? -117.04 -161.86 83 11 TYR A 128 ? ? -53.31 104.89 84 11 ALA A 182 ? ? -170.14 -160.10 85 11 GLU A 184 ? ? -53.05 99.80 86 11 ARG A 185 ? ? -169.33 118.67 87 11 ALA A 188 ? ? -144.21 -47.74 88 12 SER A 2 ? ? -159.97 -53.94 89 12 LEU A 6 ? ? -167.74 -55.93 90 12 PRO A 7 ? ? -85.29 30.12 91 12 THR A 9 ? ? -95.23 31.61 92 12 ASP A 10 ? ? 40.16 -150.15 93 12 SER A 36 ? ? -156.56 85.72 94 12 LEU A 95 ? ? -171.48 135.16 95 12 GLU A 108 ? ? -55.47 102.94 96 12 ALA A 154 ? ? -47.70 150.46 97 12 PRO A 177 ? ? -81.48 43.61 98 12 ALA A 188 ? ? -79.46 40.13 99 12 ASP A 189 ? ? -145.26 -53.78 100 13 SER A 2 ? ? -175.92 -46.14 101 13 LEU A 6 ? ? 179.52 -47.43 102 13 PRO A 7 ? ? -79.79 27.10 103 13 THR A 9 ? ? -85.60 30.26 104 13 ASP A 10 ? ? 44.48 -150.34 105 13 ALA A 139 ? ? 57.74 -90.76 106 13 PRO A 157 ? ? -48.47 164.03 107 13 PRO A 177 ? ? -67.23 58.42 108 13 ALA A 182 ? ? -112.42 -163.98 109 14 LEU A 6 ? ? -154.82 -56.17 110 14 PRO A 7 ? ? -89.45 37.38 111 14 ASP A 10 ? ? -64.02 -75.45 112 14 ASP A 119 ? ? -162.81 -165.06 113 14 SER A 164 ? ? -64.32 85.99 114 14 ALA A 182 ? ? -160.51 118.10 115 15 SER A 2 ? ? -148.47 -50.14 116 15 LEU A 6 ? ? 172.78 -55.15 117 15 THR A 9 ? ? -88.17 33.66 118 15 ASP A 10 ? ? 26.40 -104.79 119 15 SER A 36 ? ? -156.49 77.25 120 15 ASP A 119 ? ? -129.97 -169.98 121 15 TYR A 128 ? ? 34.93 55.84 122 15 ALA A 182 ? ? -120.58 -162.52 123 16 SER A 2 ? ? -161.90 113.39 124 16 LEU A 6 ? ? -171.66 -54.51 125 16 ASP A 10 ? ? -28.59 148.97 126 16 SER A 36 ? ? -159.74 81.41 127 16 PHE A 46 ? ? -65.80 99.65 128 16 LEU A 49 ? ? -67.64 81.88 129 16 TYR A 51 ? ? 168.20 112.14 130 16 TYR A 128 ? ? -62.61 99.74 131 16 SER A 164 ? ? -105.66 69.89 132 17 SER A 2 ? ? -157.00 -43.40 133 17 LEU A 6 ? ? -159.52 -53.72 134 17 ASP A 10 ? ? -42.55 156.87 135 17 SER A 36 ? ? -155.65 78.35 136 17 PRO A 39 ? ? -35.62 134.44 137 17 TYR A 51 ? ? -131.24 -158.08 138 17 ASP A 53 ? ? -122.56 -51.78 139 17 ALA A 139 ? ? 57.53 -80.53 140 17 SER A 164 ? ? -157.28 -159.62 141 17 ALA A 182 ? ? -171.83 115.49 142 18 LEU A 6 ? ? 173.87 -59.89 143 18 PRO A 7 ? ? -79.92 37.17 144 18 SER A 36 ? ? -152.93 87.04 145 18 ALA A 67 ? ? -66.00 98.53 146 18 THR A 181 ? ? -105.44 67.75 147 18 ARG A 185 ? ? -171.93 135.39 148 19 LEU A 6 ? ? -172.63 -59.98 149 19 PRO A 7 ? ? -84.06 36.25 150 19 HIS A 33 ? ? -52.93 106.36 151 19 SER A 36 ? ? -142.35 59.09 152 19 PHE A 58 ? ? -94.59 34.69 153 19 TYR A 128 ? ? 24.70 68.09 154 19 THR A 181 ? ? -97.31 58.39 155 19 ALA A 188 ? ? -148.89 21.80 156 19 ASP A 189 ? ? -128.13 -50.56 157 20 LEU A 6 ? ? -166.67 -55.05 158 20 THR A 9 ? ? -86.30 33.29 159 20 ASP A 10 ? ? 40.94 -153.38 160 20 SER A 36 ? ? -156.95 80.72 161 20 PHE A 58 ? ? -92.72 31.46 162 20 GLU A 108 ? ? -50.98 101.65 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 9 _pdbx_validate_peptide_omega.auth_comp_id_1 GLY _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 183 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 184 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 147.24 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LOK _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LOK _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.726 mM [U-100% 13C; U-100% 15N] hsr50.005, 1 x Proteinase Inhibitors, 0.02 % NaN3, 10 mM DTT, 5 mM CaCL2, 200 mM NaCL, 20 mM MES pH 6.5, 10 % D2O, 50 uM DSS, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;0.800 mM [U-100% 13C; U-100% 15N;U-2H] hsr50.009, 1 x Proteinase Inhibitors, 0.02 % NaN3, 10 mM DTT, 5 mM CaCL2, 200 mM NaCL, 20 mM MES pH 6.5, 10 % D2O, 50 uM DSS, 95% H2O/5% D2O ; 2 '95% H2O/5% D2O' ;0.674 mM [U-100% 13C; U-100% 15N] hsr50.007, 1 x Proteinase Inhibitors, 0.02 % NaN3, 10 mM DTT, 5 mM CaCL2, 200 mM NaCL, 20 mM MES pH 6.5, 10 % D2O, 50 uM DSS, 95% H2O/5% D2O ; 3 '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id hsr50.005-1 0.726 ? mM '[U-100% 13C; U-100% 15N]' 1 'Proteinase Inhibitors-2' 1 ? % ? 1 NaN3-3 0.02 ? % ? 1 DTT-4 10 ? mM ? 1 CaCL2-5 5 ? mM ? 1 NaCL-6 200 ? mM ? 1 'MES pH 6.5-7' 20 ? mM ? 1 D2O-8 10 ? % ? 1 DSS-9 50 ? uM ? 1 hsr50.009-10 0.800 ? mM '[U-100% 13C; U-100% 15N;U-2H]' 2 'Proteinase Inhibitors-11' 1 ? % ? 2 NaN3-12 0.02 ? % ? 2 DTT-13 10 ? mM ? 2 CaCL2-14 5 ? mM ? 2 NaCL-15 200 ? mM ? 2 'MES pH 6.5-16' 20 ? mM ? 2 D2O-17 10 ? % ? 2 DSS-18 50 ? uM ? 2 hsr50.007-19 0.674 ? mM '[U-100% 13C; U-100% 15N]' 3 'Proteinase Inhibitors-20' 1 ? % ? 3 NaN3-21 0.02 ? % ? 3 DTT-22 10 ? mM ? 3 CaCL2-23 5 ? mM ? 3 NaCL-24 200 ? mM ? 3 'MES pH 6.5-25' 20 ? mM ? 3 D2O-26 10 ? % ? 3 DSS-27 50 ? uM ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 2 cCH_NOESY 1 8 2 nNH_NOESY 1 9 1 '3D HNHA' 1 10 1 '3D 1H-13C NOESY' 1 11 1 '3D HCCH-TOCSY' 1 12 2 '3D 1H-13C NOESY aliphatic' 1 13 1 '3D 1H-13C NOESY aliphatic' 1 14 1 '3D 1H-13C NOESY aromatic' 1 15 1 '3D 1H-15N NOESY' 1 16 2 '3D 1H-15N NOESY' 1 17 3 '2D 1H-15N HSQC' 1 18 1 '3D HA(CO)NH' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LOK _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 3047 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2LOK _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details 'cns 1.3 with RDC, noe, dihedral and h-bonds constraints using PARAM19 force field.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 7 'Bruker Biospin' collection TopSpin ? 8 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE ? 9 Goddard 'data analysis' Sparky ? 10 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 11 'PALES (Zweckstetter, Bax)' 'geometry optimization' PALES ? 12 'Bhattacharya, Montelione' 'structure validation' PSVS ? 13 'Tejero; Montelione' 'structure validation' PdbStat 5.5-exp 14 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 192 ? A HIS 192 2 1 Y 1 A HIS 193 ? A HIS 193 3 1 Y 1 A HIS 194 ? A HIS 194 4 1 Y 1 A HIS 195 ? A HIS 195 5 1 Y 1 A HIS 196 ? A HIS 196 6 1 Y 1 A HIS 197 ? A HIS 197 7 2 Y 1 A HIS 192 ? A HIS 192 8 2 Y 1 A HIS 193 ? A HIS 193 9 2 Y 1 A HIS 194 ? A HIS 194 10 2 Y 1 A HIS 195 ? A HIS 195 11 2 Y 1 A HIS 196 ? A HIS 196 12 2 Y 1 A HIS 197 ? A HIS 197 13 3 Y 1 A HIS 192 ? A HIS 192 14 3 Y 1 A HIS 193 ? A HIS 193 15 3 Y 1 A HIS 194 ? A HIS 194 16 3 Y 1 A HIS 195 ? A HIS 195 17 3 Y 1 A HIS 196 ? A HIS 196 18 3 Y 1 A HIS 197 ? A HIS 197 19 4 Y 1 A HIS 192 ? A HIS 192 20 4 Y 1 A HIS 193 ? A HIS 193 21 4 Y 1 A HIS 194 ? A HIS 194 22 4 Y 1 A HIS 195 ? A HIS 195 23 4 Y 1 A HIS 196 ? A HIS 196 24 4 Y 1 A HIS 197 ? A HIS 197 25 5 Y 1 A HIS 192 ? A HIS 192 26 5 Y 1 A HIS 193 ? A HIS 193 27 5 Y 1 A HIS 194 ? A HIS 194 28 5 Y 1 A HIS 195 ? A HIS 195 29 5 Y 1 A HIS 196 ? A HIS 196 30 5 Y 1 A HIS 197 ? A HIS 197 31 6 Y 1 A HIS 192 ? A HIS 192 32 6 Y 1 A HIS 193 ? A HIS 193 33 6 Y 1 A HIS 194 ? A HIS 194 34 6 Y 1 A HIS 195 ? A HIS 195 35 6 Y 1 A HIS 196 ? A HIS 196 36 6 Y 1 A HIS 197 ? A HIS 197 37 7 Y 1 A HIS 192 ? A HIS 192 38 7 Y 1 A HIS 193 ? A HIS 193 39 7 Y 1 A HIS 194 ? A HIS 194 40 7 Y 1 A HIS 195 ? A HIS 195 41 7 Y 1 A HIS 196 ? A HIS 196 42 7 Y 1 A HIS 197 ? A HIS 197 43 8 Y 1 A HIS 192 ? A HIS 192 44 8 Y 1 A HIS 193 ? A HIS 193 45 8 Y 1 A HIS 194 ? A HIS 194 46 8 Y 1 A HIS 195 ? A HIS 195 47 8 Y 1 A HIS 196 ? A HIS 196 48 8 Y 1 A HIS 197 ? A HIS 197 49 9 Y 1 A HIS 192 ? A HIS 192 50 9 Y 1 A HIS 193 ? A HIS 193 51 9 Y 1 A HIS 194 ? A HIS 194 52 9 Y 1 A HIS 195 ? A HIS 195 53 9 Y 1 A HIS 196 ? A HIS 196 54 9 Y 1 A HIS 197 ? A HIS 197 55 10 Y 1 A HIS 192 ? A HIS 192 56 10 Y 1 A HIS 193 ? A HIS 193 57 10 Y 1 A HIS 194 ? A HIS 194 58 10 Y 1 A HIS 195 ? A HIS 195 59 10 Y 1 A HIS 196 ? A HIS 196 60 10 Y 1 A HIS 197 ? A HIS 197 61 11 Y 1 A HIS 192 ? A HIS 192 62 11 Y 1 A HIS 193 ? A HIS 193 63 11 Y 1 A HIS 194 ? A HIS 194 64 11 Y 1 A HIS 195 ? A HIS 195 65 11 Y 1 A HIS 196 ? A HIS 196 66 11 Y 1 A HIS 197 ? A HIS 197 67 12 Y 1 A HIS 192 ? A HIS 192 68 12 Y 1 A HIS 193 ? A HIS 193 69 12 Y 1 A HIS 194 ? A HIS 194 70 12 Y 1 A HIS 195 ? A HIS 195 71 12 Y 1 A HIS 196 ? A HIS 196 72 12 Y 1 A HIS 197 ? A HIS 197 73 13 Y 1 A HIS 192 ? A HIS 192 74 13 Y 1 A HIS 193 ? A HIS 193 75 13 Y 1 A HIS 194 ? A HIS 194 76 13 Y 1 A HIS 195 ? A HIS 195 77 13 Y 1 A HIS 196 ? A HIS 196 78 13 Y 1 A HIS 197 ? A HIS 197 79 14 Y 1 A HIS 192 ? A HIS 192 80 14 Y 1 A HIS 193 ? A HIS 193 81 14 Y 1 A HIS 194 ? A HIS 194 82 14 Y 1 A HIS 195 ? A HIS 195 83 14 Y 1 A HIS 196 ? A HIS 196 84 14 Y 1 A HIS 197 ? A HIS 197 85 15 Y 1 A HIS 192 ? A HIS 192 86 15 Y 1 A HIS 193 ? A HIS 193 87 15 Y 1 A HIS 194 ? A HIS 194 88 15 Y 1 A HIS 195 ? A HIS 195 89 15 Y 1 A HIS 196 ? A HIS 196 90 15 Y 1 A HIS 197 ? A HIS 197 91 16 Y 1 A HIS 192 ? A HIS 192 92 16 Y 1 A HIS 193 ? A HIS 193 93 16 Y 1 A HIS 194 ? A HIS 194 94 16 Y 1 A HIS 195 ? A HIS 195 95 16 Y 1 A HIS 196 ? A HIS 196 96 16 Y 1 A HIS 197 ? A HIS 197 97 17 Y 1 A HIS 192 ? A HIS 192 98 17 Y 1 A HIS 193 ? A HIS 193 99 17 Y 1 A HIS 194 ? A HIS 194 100 17 Y 1 A HIS 195 ? A HIS 195 101 17 Y 1 A HIS 196 ? A HIS 196 102 17 Y 1 A HIS 197 ? A HIS 197 103 18 Y 1 A HIS 192 ? A HIS 192 104 18 Y 1 A HIS 193 ? A HIS 193 105 18 Y 1 A HIS 194 ? A HIS 194 106 18 Y 1 A HIS 195 ? A HIS 195 107 18 Y 1 A HIS 196 ? A HIS 196 108 18 Y 1 A HIS 197 ? A HIS 197 109 19 Y 1 A HIS 192 ? A HIS 192 110 19 Y 1 A HIS 193 ? A HIS 193 111 19 Y 1 A HIS 194 ? A HIS 194 112 19 Y 1 A HIS 195 ? A HIS 195 113 19 Y 1 A HIS 196 ? A HIS 196 114 19 Y 1 A HIS 197 ? A HIS 197 115 20 Y 1 A HIS 192 ? A HIS 192 116 20 Y 1 A HIS 193 ? A HIS 193 117 20 Y 1 A HIS 194 ? A HIS 194 118 20 Y 1 A HIS 195 ? A HIS 195 119 20 Y 1 A HIS 196 ? A HIS 196 120 20 Y 1 A HIS 197 ? A HIS 197 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 900 Bruker AVANCE 2 'Bruker Avance' 600 Varian INOVA 3 'Varian INOVA' # _atom_sites.entry_id 2LOK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #