data_2LPI # _entry.id 2LPI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LPI pdb_00002lpi 10.2210/pdb2lpi/pdb RCSB RCSB102671 ? ? BMRB 18261 ? ? WWPDB D_1000102671 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 3lr2 PDB 'wild type NT dimer' unspecified 18261 BMRB . unspecified 2LPJ PDB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LPI _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-02-14 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jaudzems, K.' 1 'Nordling, K.' 2 'Landreh, M.' 3 'Rising, A.' 4 'Askarieh, G.' 5 'Knight, S.D.' 6 'Johansson, J.' 7 # _citation.id primary _citation.title 'pH-Dependent Dimerization of Spider Silk N-Terminal Domain Requires Relocation of a Wedged Tryptophan Side Chain.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 422 _citation.page_first 477 _citation.page_last 487 _citation.year 2012 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22706024 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2012.06.004 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jaudzems, K.' 1 ? primary 'Askarieh, G.' 2 ? primary 'Landreh, M.' 3 ? primary 'Nordling, K.' 4 ? primary 'Hedhammar, M.' 5 ? primary 'Jornvall, H.' 6 ? primary 'Rising, A.' 7 ? primary 'Knight, S.D.' 8 ? primary 'Johansson, J.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Major ampullate spidroin 1' _entity.formula_weight 14269.831 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation A72R _entity.pdbx_fragment 'N-terminal domain residues 24-156' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMRFASSMAEI AASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMRFASSMAEI AASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 ASN n 1 5 SER n 1 6 HIS n 1 7 THR n 1 8 THR n 1 9 PRO n 1 10 TRP n 1 11 THR n 1 12 ASN n 1 13 PRO n 1 14 GLY n 1 15 LEU n 1 16 ALA n 1 17 GLU n 1 18 ASN n 1 19 PHE n 1 20 MET n 1 21 ASN n 1 22 SER n 1 23 PHE n 1 24 MET n 1 25 GLN n 1 26 GLY n 1 27 LEU n 1 28 SER n 1 29 SER n 1 30 MET n 1 31 PRO n 1 32 GLY n 1 33 PHE n 1 34 THR n 1 35 ALA n 1 36 SER n 1 37 GLN n 1 38 LEU n 1 39 ASP n 1 40 ASP n 1 41 MET n 1 42 SER n 1 43 THR n 1 44 ILE n 1 45 ALA n 1 46 GLN n 1 47 SER n 1 48 MET n 1 49 VAL n 1 50 GLN n 1 51 SER n 1 52 ILE n 1 53 GLN n 1 54 SER n 1 55 LEU n 1 56 ALA n 1 57 ALA n 1 58 GLN n 1 59 GLY n 1 60 ARG n 1 61 THR n 1 62 SER n 1 63 PRO n 1 64 ASN n 1 65 LYS n 1 66 LEU n 1 67 GLN n 1 68 ALA n 1 69 LEU n 1 70 ASN n 1 71 MET n 1 72 ARG n 1 73 PHE n 1 74 ALA n 1 75 SER n 1 76 SER n 1 77 MET n 1 78 ALA n 1 79 GLU n 1 80 ILE n 1 81 ALA n 1 82 ALA n 1 83 SER n 1 84 GLU n 1 85 GLU n 1 86 GLY n 1 87 GLY n 1 88 GLY n 1 89 SER n 1 90 LEU n 1 91 SER n 1 92 THR n 1 93 LYS n 1 94 THR n 1 95 SER n 1 96 SER n 1 97 ILE n 1 98 ALA n 1 99 SER n 1 100 ALA n 1 101 MET n 1 102 SER n 1 103 ASN n 1 104 ALA n 1 105 PHE n 1 106 LEU n 1 107 GLN n 1 108 THR n 1 109 THR n 1 110 GLY n 1 111 VAL n 1 112 VAL n 1 113 ASN n 1 114 GLN n 1 115 PRO n 1 116 PHE n 1 117 ILE n 1 118 ASN n 1 119 GLU n 1 120 ILE n 1 121 THR n 1 122 GLN n 1 123 LEU n 1 124 VAL n 1 125 SER n 1 126 MET n 1 127 PHE n 1 128 ALA n 1 129 GLN n 1 130 ALA n 1 131 GLY n 1 132 MET n 1 133 ASN n 1 134 ASP n 1 135 VAL n 1 136 SER n 1 137 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MaSp1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Euprosthenops australis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 332052 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q05H60_9ARAC _struct_ref.pdbx_db_accession Q05H60 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASE EGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA ; _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LPI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 137 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q05H60 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 156 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 137 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LPI GLY A 1 ? UNP Q05H60 ? ? 'expression tag' 1 1 1 2LPI SER A 2 ? UNP Q05H60 ? ? 'expression tag' 2 2 1 2LPI GLY A 3 ? UNP Q05H60 ? ? 'expression tag' 3 3 1 2LPI ASN A 4 ? UNP Q05H60 ? ? 'expression tag' 4 4 1 2LPI ARG A 72 ? UNP Q05H60 ALA 91 'engineered mutation' 72 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCA' 1 4 1 '3D HNCO' 1 5 1 '3D HN(CA)CO' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D 1H-13C NOESY aliphatic' 1 8 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.064 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;1.4 mM [U-99% 13C; U-99% 15N] Major ampullate spidroin 1, 20 mM sodium phosphate, 20 mM sodium chloride, 0.03 % sodium azide, 5 % [U-100% 2H] D2O, 95% H2O/5% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LPI _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 80 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LPI _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LPI _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 Varian collection VnmrJ 2.1b 4 'T. Herrmann, F. Fiorito, J. Volk' 'peak picking' UNIO 2.0.2 5 'T. Herrmann, F. Fiorito, J. Volk' 'data analysis' UNIO 2.0.2 6 'T. Herrmann, F. Fiorito, J. Volk' 'structure solution' UNIO 2.0.2 7 'R. Keller' 'chemical shift assignment' CARA 1.9.0 8 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 9 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LPI _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LPI _struct.title 'NMR structure of a monomeric mutant (A72R) of major ampullate spidroin 1 N-terminal domain' _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LPI _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text 'STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 12 ? SER A 28 ? ASN A 12 SER A 28 1 ? 17 HELX_P HELX_P2 2 THR A 34 ? GLY A 59 ? THR A 34 GLY A 59 1 ? 26 HELX_P HELX_P3 3 SER A 62 ? ALA A 82 ? SER A 62 ALA A 82 1 ? 21 HELX_P HELX_P4 4 SER A 89 ? THR A 109 ? SER A 89 THR A 109 1 ? 21 HELX_P HELX_P5 5 ASN A 113 ? ASN A 133 ? ASN A 113 ASN A 133 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2LPI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 TRP 10 10 10 TRP TRP A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 MET 126 126 126 MET MET A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 MET 132 132 132 MET MET A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ALA 137 137 137 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-06-27 2 'Structure model' 1 1 2012-09-12 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Major ampullate spidroin 1-1' 1.4 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 20 ? mM ? 1 'sodium azide-4' 0.03 ? % ? 1 D2O-5 5 ? % '[U-100% 2H]' 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 OE1 A GLU 84 ? ? HZ1 A LYS 93 ? ? 1.57 2 6 OE1 A GLU 84 ? ? HZ2 A LYS 93 ? ? 1.59 3 10 OE1 A GLU 84 ? ? HZ2 A LYS 93 ? ? 1.57 4 11 OE2 A GLU 84 ? ? HZ2 A LYS 93 ? ? 1.57 5 19 OE1 A GLU 84 ? ? HZ1 A LYS 93 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 7 ? ? -170.58 -178.55 2 1 PHE A 33 ? ? -105.85 -169.47 3 1 GLU A 84 ? ? 57.35 74.24 4 2 SER A 5 ? ? 60.12 91.16 5 2 GLU A 84 ? ? 48.45 78.52 6 2 SER A 89 ? ? 177.47 118.28 7 2 MET A 132 ? ? -107.80 -74.32 8 3 ASN A 4 ? ? -61.90 -81.84 9 4 HIS A 6 ? ? -101.25 41.39 10 4 PHE A 33 ? ? -120.55 -168.00 11 4 SER A 83 ? ? -84.80 47.46 12 4 GLU A 84 ? ? -80.65 48.26 13 4 ASP A 134 ? ? -68.19 86.30 14 5 HIS A 6 ? ? -52.80 106.43 15 5 SER A 83 ? ? -84.23 49.61 16 5 SER A 89 ? ? 72.63 127.77 17 5 VAL A 135 ? ? -141.52 12.43 18 5 SER A 136 ? ? -107.06 79.74 19 6 THR A 7 ? ? -65.27 96.68 20 6 SER A 89 ? ? 169.58 92.08 21 6 THR A 108 ? ? -92.32 -65.17 22 7 SER A 2 ? ? -84.57 45.11 23 7 ASN A 4 ? ? -114.02 51.90 24 7 THR A 108 ? ? -103.42 -67.94 25 7 MET A 132 ? ? -78.35 -85.27 26 8 SER A 136 ? ? 164.77 133.22 27 9 ASN A 4 ? ? -79.74 -75.96 28 9 MET A 132 ? ? -87.28 -93.13 29 9 ASN A 133 ? ? -178.42 -178.22 30 10 SER A 5 ? ? -155.31 89.18 31 10 LEU A 15 ? ? -142.98 -55.79 32 10 PHE A 33 ? ? -109.02 -165.84 33 10 THR A 61 ? ? -65.78 -70.87 34 10 SER A 62 ? ? 50.80 160.46 35 10 SER A 83 ? ? -102.81 72.58 36 10 GLU A 85 ? ? -113.24 -72.58 37 10 SER A 89 ? ? 177.57 123.46 38 10 MET A 132 ? ? -108.72 -63.35 39 11 ASN A 4 ? ? -155.26 -47.21 40 11 SER A 5 ? ? -68.36 88.44 41 11 THR A 108 ? ? -96.28 -70.14 42 11 ASN A 133 ? ? -163.70 118.61 43 11 ASP A 134 ? ? 59.96 99.42 44 11 VAL A 135 ? ? -168.67 20.37 45 12 SER A 2 ? ? -101.32 -62.45 46 12 SER A 5 ? ? -70.99 -166.81 47 12 HIS A 6 ? ? -67.59 99.63 48 12 MET A 132 ? ? -130.35 -65.10 49 12 ASP A 134 ? ? -81.31 32.54 50 13 THR A 61 ? ? -69.64 95.16 51 14 HIS A 6 ? ? 46.46 27.16 52 14 GLU A 85 ? ? -95.43 -60.26 53 14 MET A 132 ? ? -99.29 -78.22 54 14 ASN A 133 ? ? -174.91 -171.93 55 15 LEU A 15 ? ? -120.93 -57.76 56 15 PHE A 33 ? ? -102.39 -169.14 57 15 MET A 132 ? ? -92.00 -78.03 58 15 SER A 136 ? ? -83.26 48.63 59 16 SER A 5 ? ? -160.53 -167.48 60 16 PHE A 33 ? ? -122.57 -168.88 61 17 SER A 89 ? ? -158.67 52.51 62 17 ALA A 130 ? ? 57.67 5.71 63 17 ASP A 134 ? ? 61.31 63.07 64 18 SER A 62 ? ? -172.95 144.11 65 18 SER A 89 ? ? 72.21 112.57 66 18 VAL A 135 ? ? -151.25 12.92 67 19 ASN A 4 ? ? -81.49 -71.94 68 19 THR A 11 ? ? -71.34 -72.77 69 19 VAL A 135 ? ? -145.58 27.02 70 20 ASN A 4 ? ? -150.95 -9.26 71 20 SER A 62 ? ? 50.40 165.28 72 20 GLU A 84 ? ? 56.25 91.38 73 20 THR A 108 ? ? -94.13 -61.54 #