data_2LQ9 # _entry.id 2LQ9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LQ9 pdb_00002lq9 10.2210/pdb2lq9/pdb RCSB RCSB102697 ? ? BMRB 18299 ? ? WWPDB D_1000102697 ? ? # _pdbx_database_related.db_id 18299 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LQ9 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2012-02-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xi, Z.' 1 'Shi, C.' 2 'Lai, C.' 3 'Tian, C.' 4 'Liu, Y.' 5 # _citation.id primary _citation.title 'Solution structure of the K60A mutant of Atox1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xi, Z.' 1 ? primary 'Shi, C.' 2 ? primary 'Lai, C.' 3 ? primary 'Tian, C.' 4 ? primary 'Liu, Y.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Copper transport protein ATOX1' _entity.formula_weight 7354.545 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation K60A _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Metal transport protein ATX1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGATVSYLGLE _entity_poly.pdbx_seq_one_letter_code_can MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGATVSYLGLE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 LYS n 1 4 HIS n 1 5 GLU n 1 6 PHE n 1 7 SER n 1 8 VAL n 1 9 ASP n 1 10 MET n 1 11 THR n 1 12 CYS n 1 13 GLY n 1 14 GLY n 1 15 CYS n 1 16 ALA n 1 17 GLU n 1 18 ALA n 1 19 VAL n 1 20 SER n 1 21 ARG n 1 22 VAL n 1 23 LEU n 1 24 ASN n 1 25 LYS n 1 26 LEU n 1 27 GLY n 1 28 GLY n 1 29 VAL n 1 30 LYS n 1 31 TYR n 1 32 ASP n 1 33 ILE n 1 34 ASP n 1 35 LEU n 1 36 PRO n 1 37 ASN n 1 38 LYS n 1 39 LYS n 1 40 VAL n 1 41 CYS n 1 42 ILE n 1 43 GLU n 1 44 SER n 1 45 GLU n 1 46 HIS n 1 47 SER n 1 48 MET n 1 49 ASP n 1 50 THR n 1 51 LEU n 1 52 LEU n 1 53 ALA n 1 54 THR n 1 55 LEU n 1 56 LYS n 1 57 LYS n 1 58 THR n 1 59 GLY n 1 60 ALA n 1 61 THR n 1 62 VAL n 1 63 SER n 1 64 TYR n 1 65 LEU n 1 66 GLY n 1 67 LEU n 1 68 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ATOX1, HAH1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pST-SG1 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATOX1_HUMAN _struct_ref.pdbx_db_accession O00244 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LQ9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O00244 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 68 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 68 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2LQ9 _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 60 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O00244 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 60 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 60 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D C(CO)NH' 1 5 1 '3D HNCO' 1 6 1 '3D HNCACB' 1 7 1 '3D HBHA(CO)NH' 1 8 1 '3D H(CCO)NH' 1 9 2 '3D 1H-15N NOESY' 1 10 3 '3D 1H-13C NOESY' 1 11 3 '3D HCCH-COSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.215 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.4-0.5 mM [U-100% 13C; U-100% 15N] entity-1, 100 mM sodium phosphate-2, 2-2.5 mM DTT-3, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.4-0.5 mM [U-100% 15N] entity-4, 100 mM sodium phosphate-5, 2-2.5 mM DTT-6, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '0.4-0.5 mM [U-100% 13C; U-100% 15N] entity-7, 100 mM sodium phosphate-8, 2-2.5 mM DTT-9, 100% D2O' 3 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LQ9 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LQ9 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LQ9 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 1 ? 'Johnson, One Moon Scientific' 'peak picking' NMRView 2 ? 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView 3 ? Goddard 'peak picking' Sparky 4 ? Goddard 'chemical shift assignment' Sparky 5 ? 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 6 ? 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 7 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LQ9 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LQ9 _struct.title 'Solution structure of the K60A mutant of Atox1' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LQ9 _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'K60A Atox1, METAL BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 12 ? GLY A 27 ? CYS A 12 GLY A 27 1 ? 16 HELX_P HELX_P2 2 ASP A 49 ? THR A 58 ? ASP A 49 THR A 58 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 30 ? ASP A 34 ? LYS A 30 ASP A 34 A 2 LYS A 39 ? GLU A 43 ? LYS A 39 GLU A 43 A 3 HIS A 4 ? VAL A 8 ? HIS A 4 VAL A 8 A 4 VAL A 62 ? LEU A 67 ? VAL A 62 LEU A 67 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 30 ? N LYS A 30 O GLU A 43 ? O GLU A 43 A 2 3 O ILE A 42 ? O ILE A 42 N HIS A 4 ? N HIS A 4 A 3 4 N SER A 7 ? N SER A 7 O SER A 63 ? O SER A 63 # _atom_sites.entry_id 2LQ9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-03-27 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 ? 0.4-0.5 mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate-2' 100 ? mM ? 1 DTT-3 ? 2-2.5 mM ? 1 entity-4 ? 0.4-0.5 mM '[U-100% 15N]' 2 'sodium phosphate-5' 100 ? mM ? 2 DTT-6 ? 2-2.5 mM ? 2 entity-7 ? 0.4-0.5 mM '[U-100% 13C; U-100% 15N]' 3 'sodium phosphate-8' 100 ? mM ? 3 DTT-9 ? 2-2.5 mM ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A CYS 12 ? ? H A ALA 16 ? ? 1.48 2 1 O A LEU 23 ? ? H A GLY 27 ? ? 1.52 3 2 O A CYS 12 ? ? H A ALA 16 ? ? 1.50 4 3 O A CYS 12 ? ? H A ALA 16 ? ? 1.51 5 3 O A LEU 23 ? ? H A GLY 27 ? ? 1.54 6 3 O A LYS 56 ? ? H A GLY 59 ? ? 1.60 7 4 O A CYS 12 ? ? H A ALA 16 ? ? 1.53 8 4 O A LEU 23 ? ? H A GLY 27 ? ? 1.55 9 5 O A LEU 23 ? ? H A GLY 27 ? ? 1.55 10 5 O A CYS 12 ? ? H A ALA 16 ? ? 1.57 11 5 O A LEU 51 ? ? H A LEU 55 ? ? 1.60 12 6 O A CYS 12 ? ? H A ALA 16 ? ? 1.50 13 6 O A LEU 51 ? ? H A LEU 55 ? ? 1.58 14 7 O A CYS 12 ? ? H A ALA 16 ? ? 1.54 15 8 O A CYS 12 ? ? H A ALA 16 ? ? 1.51 16 8 O A LEU 23 ? ? H A GLY 27 ? ? 1.59 17 9 O A CYS 12 ? ? H A ALA 16 ? ? 1.50 18 9 O A LEU 23 ? ? H A GLY 27 ? ? 1.55 19 10 O A CYS 12 ? ? H A ALA 16 ? ? 1.53 20 10 O A LEU 23 ? ? H A GLY 27 ? ? 1.55 21 11 O A CYS 12 ? ? H A ALA 16 ? ? 1.49 22 12 HD1 A HIS 4 ? ? HG A SER 47 ? ? 1.29 23 12 O A CYS 12 ? ? H A ALA 16 ? ? 1.49 24 12 O A LEU 23 ? ? H A GLY 27 ? ? 1.52 25 13 O A CYS 12 ? ? H A ALA 16 ? ? 1.48 26 13 O A LEU 23 ? ? H A GLY 27 ? ? 1.57 27 14 O A CYS 12 ? ? H A ALA 16 ? ? 1.50 28 14 O A LEU 23 ? ? H A GLY 27 ? ? 1.57 29 14 O A LEU 52 ? ? H A LYS 56 ? ? 1.59 30 15 O A CYS 12 ? ? H A ALA 16 ? ? 1.50 31 15 O A LEU 23 ? ? H A GLY 27 ? ? 1.53 32 15 O A LEU 51 ? ? H A LEU 55 ? ? 1.59 33 16 O A CYS 12 ? ? H A ALA 16 ? ? 1.51 34 16 O A LEU 23 ? ? H A GLY 27 ? ? 1.52 35 17 O A CYS 12 ? ? H A ALA 16 ? ? 1.50 36 17 O A LEU 23 ? ? H A GLY 27 ? ? 1.55 37 17 O A THR 50 ? ? HG1 A THR 54 ? ? 1.59 38 18 O A CYS 12 ? ? H A ALA 16 ? ? 1.51 39 18 O A LEU 23 ? ? H A GLY 27 ? ? 1.53 40 18 O A LYS 56 ? ? H A GLY 59 ? ? 1.58 41 19 O A CYS 12 ? ? H A ALA 16 ? ? 1.48 42 20 O A CYS 12 ? ? H A ALA 16 ? ? 1.51 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 12 ? ? -107.04 40.95 2 1 SER A 47 ? ? 59.58 137.63 3 1 MET A 48 ? ? 70.40 54.96 4 1 ASP A 49 ? ? -179.04 -40.48 5 2 HIS A 46 ? ? -94.54 -65.51 6 2 MET A 48 ? ? 154.15 48.87 7 2 ASP A 49 ? ? -172.05 -39.64 8 3 SER A 47 ? ? 63.89 160.42 9 3 MET A 48 ? ? 71.80 34.74 10 3 ASP A 49 ? ? -163.12 -40.63 11 4 HIS A 46 ? ? -86.71 -73.11 12 4 SER A 47 ? ? 89.69 105.52 13 4 MET A 48 ? ? 67.31 60.69 14 4 ASP A 49 ? ? -173.16 -34.95 15 5 SER A 47 ? ? 70.44 116.64 16 5 MET A 48 ? ? 84.82 65.62 17 5 ASP A 49 ? ? 171.56 -40.17 18 6 CYS A 12 ? ? -97.98 31.55 19 6 SER A 47 ? ? 61.06 124.96 20 6 MET A 48 ? ? 87.78 44.31 21 6 ASP A 49 ? ? -173.45 -38.03 22 7 CYS A 12 ? ? -99.31 30.70 23 7 SER A 47 ? ? 60.32 119.40 24 7 MET A 48 ? ? 91.25 63.18 25 7 ASP A 49 ? ? 170.62 -42.76 26 8 HIS A 46 ? ? -76.37 -93.97 27 8 SER A 47 ? ? 86.24 107.58 28 8 MET A 48 ? ? 98.35 52.91 29 8 ASP A 49 ? ? 174.07 -37.51 30 9 SER A 47 ? ? 70.94 153.58 31 9 ASP A 49 ? ? -160.25 -37.12 32 10 VAL A 29 ? ? -127.56 -168.38 33 10 MET A 48 ? ? 160.76 61.90 34 10 ASP A 49 ? ? 169.23 -30.38 35 11 MET A 48 ? ? -178.95 47.66 36 11 ASP A 49 ? ? 171.05 -29.51 37 11 LYS A 57 ? ? -29.17 -49.84 38 12 CYS A 12 ? ? -96.41 35.70 39 12 SER A 47 ? ? 58.73 115.87 40 12 MET A 48 ? ? 86.85 61.28 41 12 ASP A 49 ? ? 173.87 -42.02 42 13 CYS A 12 ? ? -96.43 35.75 43 13 SER A 47 ? ? 48.04 166.60 44 13 MET A 48 ? ? 71.13 60.30 45 13 ASP A 49 ? ? 161.30 -40.29 46 14 SER A 47 ? ? 61.81 127.45 47 14 MET A 48 ? ? 87.23 61.64 48 14 ASP A 49 ? ? 169.85 -42.05 49 15 SER A 47 ? ? 55.70 123.30 50 15 MET A 48 ? ? 88.54 69.14 51 15 ASP A 49 ? ? 163.50 -38.00 52 16 SER A 47 ? ? 57.82 -179.93 53 16 ASP A 49 ? ? -158.10 -37.66 54 17 MET A 48 ? ? -166.76 50.88 55 17 ASP A 49 ? ? 174.17 -33.57 56 18 SER A 47 ? ? 59.04 133.94 57 18 MET A 48 ? ? 77.04 50.20 58 18 ASP A 49 ? ? -171.77 -41.46 59 19 HIS A 46 ? ? -101.11 -71.51 60 19 SER A 47 ? ? 61.43 153.00 61 19 MET A 48 ? ? 71.75 37.13 62 19 ASP A 49 ? ? -170.40 -41.35 63 20 HIS A 46 ? ? -74.65 -72.36 64 20 SER A 47 ? ? 75.14 104.24 65 20 MET A 48 ? ? 80.98 57.90 66 20 ASP A 49 ? ? -174.94 -41.34 #