data_2LQB # _entry.id 2LQB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LQB pdb_00002lqb 10.2210/pdb2lqb/pdb RCSB RCSB102699 ? ? BMRB 18301 ? ? WWPDB D_1000102699 ? ? # _pdbx_database_related.db_id 18301 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LQB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-02-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nokhrin, S.' 1 'Dolgova, N.V.' 2 'Yu, C.' 3 'Dmitriev, O.Y.' 4 # _citation.id primary _citation.title ;Copper chaperone Atox1 interacts with the metal-binding domain of Wilson's disease protein in cisplatin detoxification. ; _citation.journal_abbrev Biochem.J. _citation.journal_volume 454 _citation.page_first 147 _citation.page_last 156 _citation.year 2013 _citation.journal_id_ASTM BIJOAK _citation.country UK _citation.journal_id_ISSN 0264-6021 _citation.journal_id_CSD 0043 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23751120 _citation.pdbx_database_id_DOI 10.1042/BJ20121656 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dolgova, N.V.' 1 ? primary 'Nokhrin, S.' 2 ? primary 'Yu, C.H.' 3 ? primary 'George, G.N.' 4 ? primary 'Dmitriev, O.Y.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Copper-transporting ATPase 2' _entity.formula_weight 8427.712 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.6.3.4 _entity.pdbx_mutation ? _entity.pdbx_fragment 'HMA 2 domain residues 141-212' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Copper pump 2, Wilson disease-associated protein, WND/140 kDa' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AGHMQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKS _entity_poly.pdbx_seq_one_letter_code_can AGHMQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLY n 1 3 HIS n 1 4 MET n 1 5 GLN n 1 6 GLU n 1 7 ALA n 1 8 VAL n 1 9 VAL n 1 10 LYS n 1 11 LEU n 1 12 ARG n 1 13 VAL n 1 14 GLU n 1 15 GLY n 1 16 MET n 1 17 THR n 1 18 CYS n 1 19 GLN n 1 20 SER n 1 21 CYS n 1 22 VAL n 1 23 SER n 1 24 SER n 1 25 ILE n 1 26 GLU n 1 27 GLY n 1 28 LYS n 1 29 VAL n 1 30 ARG n 1 31 LYS n 1 32 LEU n 1 33 GLN n 1 34 GLY n 1 35 VAL n 1 36 VAL n 1 37 ARG n 1 38 VAL n 1 39 LYS n 1 40 VAL n 1 41 SER n 1 42 LEU n 1 43 SER n 1 44 ASN n 1 45 GLN n 1 46 GLU n 1 47 ALA n 1 48 VAL n 1 49 ILE n 1 50 THR n 1 51 TYR n 1 52 GLN n 1 53 PRO n 1 54 TYR n 1 55 LEU n 1 56 ILE n 1 57 GLN n 1 58 PRO n 1 59 GLU n 1 60 ASP n 1 61 LEU n 1 62 ARG n 1 63 ASP n 1 64 HIS n 1 65 VAL n 1 66 ASN n 1 67 ASP n 1 68 MET n 1 69 GLY n 1 70 PHE n 1 71 GLU n 1 72 ALA n 1 73 ALA n 1 74 ILE n 1 75 LYS n 1 76 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ATP7B, PWD, WC1, WND' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pTYB12 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATP7B_HUMAN _struct_ref.pdbx_db_accession P35670 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKS _struct_ref.pdbx_align_begin 141 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LQB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 76 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P35670 _struct_ref_seq.db_align_beg 141 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 212 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 76 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LQB ALA A 1 ? UNP P35670 ? ? 'expression tag' 1 1 1 2LQB GLY A 2 ? UNP P35670 ? ? 'expression tag' 2 2 1 2LQB HIS A 3 ? UNP P35670 ? ? 'expression tag' 3 3 1 2LQB MET A 4 ? UNP P35670 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCO' 1 3 1 '3D HNCA' 1 4 1 '3D HNCACB' 1 5 1 '3D HN(COCA)CB' 1 6 1 '3D C(CO)NH' 1 7 1 '3D H(CCO)NH' 1 8 1 '3D 1H-15N TOCSY' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '3D 1H-13C NOESY' 1 11 1 '3D HN(CA)CO' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '50 mM [U-2H] Tris-Cl, 0.5 mM DSS, 0.05 mM sodium azide, 5 % [U-2H] D2O, 5 mM TCEP (tris(2-carboxyethyl)phosphine), 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LQB _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LQB _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.56 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LQB _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 1 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign ? 2 'F. Damberger, R. Keller' 'chemical shift assignment' CARA 1.9.0 3 'Accelrys Software Inc.' processing Felix ? 4 'Accelrys Software Inc.' 'peak picking' Felix ? 5 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LQB _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LQB _struct.title 'Metal binding repeat 2 of the Wilson disease protein (ATP7B)' _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LQB _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'copper binding, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 20 ? VAL A 29 ? SER A 20 VAL A 29 1 ? 10 HELX_P HELX_P2 2 ARG A 30 ? LEU A 32 ? ARG A 30 LEU A 32 5 ? 3 HELX_P HELX_P3 3 GLN A 57 ? ASP A 67 ? GLN A 57 ASP A 67 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 37 ? SER A 41 ? ARG A 37 SER A 41 A 2 GLU A 46 ? TYR A 51 ? GLU A 46 TYR A 51 A 3 ALA A 7 ? VAL A 13 ? ALA A 7 VAL A 13 A 4 ALA A 72 ? ILE A 74 ? ALA A 72 ILE A 74 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 39 ? N LYS A 39 O VAL A 48 ? O VAL A 48 A 2 3 O ILE A 49 ? O ILE A 49 N VAL A 9 ? N VAL A 9 A 3 4 N ARG A 12 ? N ARG A 12 O ALA A 73 ? O ALA A 73 # _atom_sites.entry_id 2LQB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 SER 76 76 76 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-07-03 2 'Structure model' 1 1 2013-07-24 3 'Structure model' 1 2 2013-08-14 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.37 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.12 _pdbx_nmr_ensemble_rms.entry_id 2LQB _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Tris-Cl-1 50 ? mM '[U-2H]' 1 DSS-2 0.5 ? mM ? 1 'sodium azide-3' 0.05 ? mM ? 1 D2O-4 5 ? % '[U-2H]' 1 'TCEP (tris(2-carboxyethyl)phosphine)-5' 5 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LQB _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 894 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 253 _pdbx_nmr_constraints.NOE_long_range_total_count 227 _pdbx_nmr_constraints.NOE_medium_range_total_count 145 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 269 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 66 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 66 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 19 ? ? -57.03 179.17 2 1 GLN A 33 ? ? -86.31 -72.69 3 1 LEU A 55 ? ? -111.62 -75.65 4 2 HIS A 3 ? ? -161.49 106.32 5 2 CYS A 18 ? ? -54.36 176.14 6 2 GLN A 33 ? ? -85.02 -76.03 7 2 LEU A 55 ? ? -108.78 -74.97 8 3 GLN A 33 ? ? -83.96 -72.00 9 3 LEU A 55 ? ? -108.94 -71.74 10 4 MET A 16 ? ? -60.84 -167.69 11 4 GLN A 19 ? ? 60.48 66.85 12 4 SER A 20 ? ? -178.68 -35.75 13 4 LEU A 55 ? ? -109.51 -70.13 14 4 LYS A 75 ? ? -89.29 -154.03 15 5 MET A 16 ? ? -57.85 -176.31 16 5 SER A 20 ? ? -90.52 47.82 17 5 LEU A 55 ? ? -108.09 -70.91 18 5 ALA A 72 ? ? -39.90 137.28 19 6 GLN A 33 ? ? -84.85 -76.00 20 6 LEU A 55 ? ? -109.73 -75.13 21 7 THR A 17 ? ? -139.67 -73.91 22 7 GLN A 19 ? ? -69.34 99.81 23 7 SER A 20 ? ? 179.06 -37.09 24 7 LEU A 55 ? ? -113.13 -70.59 25 8 GLN A 19 ? ? -53.43 172.05 26 8 SER A 20 ? ? -109.23 61.34 27 8 GLN A 33 ? ? -83.87 -71.29 28 8 LEU A 55 ? ? -107.37 -73.10 29 9 THR A 17 ? ? -138.46 -74.46 30 9 SER A 20 ? ? -89.74 48.47 31 9 LEU A 55 ? ? -112.64 -70.11 32 10 MET A 4 ? ? -110.97 51.77 33 10 LEU A 55 ? ? -108.56 -69.87 34 11 HIS A 3 ? ? -120.76 -59.43 35 11 GLN A 19 ? ? -51.06 103.38 36 11 SER A 20 ? ? 180.00 -53.30 37 11 LEU A 55 ? ? -111.72 -70.98 38 12 LEU A 55 ? ? -108.02 -74.50 39 13 LYS A 10 ? ? -26.89 131.31 40 14 MET A 4 ? ? 39.38 41.75 41 14 LYS A 10 ? ? -27.14 132.39 42 14 THR A 17 ? ? -143.85 -49.92 43 14 CYS A 18 ? ? -108.80 -169.42 44 14 SER A 20 ? ? -146.93 -62.64 45 14 LEU A 55 ? ? -111.15 -76.36 46 15 MET A 4 ? ? -97.28 42.57 47 15 MET A 16 ? ? 40.43 29.44 48 15 THR A 17 ? ? -49.85 167.51 49 15 LEU A 55 ? ? -113.09 -70.92 50 16 CYS A 18 ? ? 48.66 78.37 51 16 SER A 20 ? ? -95.96 33.27 52 16 GLN A 33 ? ? -83.87 -74.39 53 16 LEU A 55 ? ? -111.43 -74.91 54 17 MET A 16 ? ? 38.97 30.53 55 17 CYS A 18 ? ? 62.37 66.85 56 17 LEU A 55 ? ? -107.48 -69.12 57 18 HIS A 3 ? ? -126.59 -73.77 58 18 CYS A 18 ? ? -55.38 179.18 59 18 GLN A 19 ? ? -51.09 -75.80 60 18 SER A 20 ? ? -169.61 61.33 61 18 LEU A 55 ? ? -108.59 -72.32 62 19 CYS A 18 ? ? -60.94 -74.87 63 19 SER A 20 ? ? -89.61 47.67 64 20 HIS A 3 ? ? -121.37 -56.68 65 20 MET A 16 ? ? 38.71 30.48 66 20 LEU A 55 ? ? -108.27 -70.49 67 20 LYS A 75 ? ? -65.52 -74.09 #