data_2LQC # _entry.id 2LQC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LQC pdb_00002lqc 10.2210/pdb2lqc/pdb RCSB RCSB102700 ? ? BMRB 18302 ? 10.13018/BMR18302 WWPDB D_1000102700 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-06-06 2 'Structure model' 1 1 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_software 5 2 'Structure model' pdbx_nmr_spectrometer 6 2 'Structure model' pdbx_struct_conn_angle 7 2 'Structure model' struct_conn 8 2 'Structure model' struct_ref_seq_dif 9 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_nmr_software.name' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.value' 16 2 'Structure model' '_struct_conn.pdbx_dist_value' 17 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 2 'Structure model' '_struct_ref_seq_dif.details' 25 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 26 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 27 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LQC _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-02-29 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_id 18302 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _audit_author.name 'Liu, Z.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title ;Structural basis for the regulation of L-type voltage-gated calcium channels: interactions between the N-terminal cytoplasmic domain and Ca(2+)-calmodulin. ; _citation.journal_abbrev 'Front Mol Neurosci' _citation.journal_volume 5 _citation.page_first 38 _citation.page_last 38 _citation.year 2012 _citation.journal_id_ASTM ? _citation.country CH _citation.journal_id_ISSN 1662-5099 _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22518098 _citation.pdbx_database_id_DOI 10.3389/fnmol.2012.00038 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, Z.' 1 ? primary 'Vogel, H.J.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Calmodulin 8583.532 1 ? ? 'EF-hands 1 and 2' ? 2 polymer man 'Voltage-dependent L-type calcium channel subunit alpha-1C' 2347.650 1 ? ? 'UNP residues 47-68' ? 3 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 CaM 2 'Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle, Voltage-gated calcium channel subunit alpha Cav1.2' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMK ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMK A ? 2 'polypeptide(L)' no no GTGAALSWQAAIDAARQAKLMGSA GTGAALSWQAAIDAARQAKLMGSA B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 GLN n 1 4 LEU n 1 5 THR n 1 6 GLU n 1 7 GLU n 1 8 GLN n 1 9 ILE n 1 10 ALA n 1 11 GLU n 1 12 PHE n 1 13 LYS n 1 14 GLU n 1 15 ALA n 1 16 PHE n 1 17 SER n 1 18 LEU n 1 19 PHE n 1 20 ASP n 1 21 LYS n 1 22 ASP n 1 23 GLY n 1 24 ASP n 1 25 GLY n 1 26 THR n 1 27 ILE n 1 28 THR n 1 29 THR n 1 30 LYS n 1 31 GLU n 1 32 LEU n 1 33 GLY n 1 34 THR n 1 35 VAL n 1 36 MET n 1 37 ARG n 1 38 SER n 1 39 LEU n 1 40 GLY n 1 41 GLN n 1 42 ASN n 1 43 PRO n 1 44 THR n 1 45 GLU n 1 46 ALA n 1 47 GLU n 1 48 LEU n 1 49 GLN n 1 50 ASP n 1 51 MET n 1 52 ILE n 1 53 ASN n 1 54 GLU n 1 55 VAL n 1 56 ASP n 1 57 ALA n 1 58 ASP n 1 59 GLY n 1 60 ASN n 1 61 GLY n 1 62 THR n 1 63 ILE n 1 64 ASP n 1 65 PHE n 1 66 PRO n 1 67 GLU n 1 68 PHE n 1 69 LEU n 1 70 THR n 1 71 MET n 1 72 MET n 1 73 ALA n 1 74 ARG n 1 75 LYS n 1 76 MET n 1 77 LYS n 2 1 GLY n 2 2 THR n 2 3 GLY n 2 4 ALA n 2 5 ALA n 2 6 LEU n 2 7 SER n 2 8 TRP n 2 9 GLN n 2 10 ALA n 2 11 ALA n 2 12 ILE n 2 13 ASP n 2 14 ALA n 2 15 ALA n 2 16 ARG n 2 17 GLN n 2 18 ALA n 2 19 LYS n 2 20 LEU n 2 21 MET n 2 22 GLY n 2 23 SER n 2 24 ALA n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? human ? 'CALM1, CALM, CAM, CAM1, CALM2, CAM2, CAMB, CALM3, CALML2, CAM3, CAMC, CAMIII' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? pET30b+ ? ? ? ? ? 2 1 sample ? ? ? human ? 'CACNA1C, CACH2, CACN2, CACNL1A1, CCHL1A1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? pET15b ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 LYS 77 77 77 LYS LYS A . n B 2 1 GLY 1 45 45 GLY GLY B . n B 2 2 THR 2 46 46 THR THR B . n B 2 3 GLY 3 47 47 GLY GLY B . n B 2 4 ALA 4 48 48 ALA ALA B . n B 2 5 ALA 5 49 49 ALA ALA B . n B 2 6 LEU 6 50 50 LEU LEU B . n B 2 7 SER 7 51 51 SER SER B . n B 2 8 TRP 8 52 52 TRP TRP B . n B 2 9 GLN 9 53 53 GLN GLN B . n B 2 10 ALA 10 54 54 ALA ALA B . n B 2 11 ALA 11 55 55 ALA ALA B . n B 2 12 ILE 12 56 56 ILE ILE B . n B 2 13 ASP 13 57 57 ASP ASP B . n B 2 14 ALA 14 58 58 ALA ALA B . n B 2 15 ALA 15 59 59 ALA ALA B . n B 2 16 ARG 16 60 60 ARG ARG B . n B 2 17 GLN 17 61 61 GLN GLN B . n B 2 18 ALA 18 62 62 ALA ALA B . n B 2 19 LYS 19 63 63 LYS LYS B . n B 2 20 LEU 20 64 64 LEU LEU B . n B 2 21 MET 21 65 65 MET MET B . n B 2 22 GLY 22 66 66 GLY GLY B . n B 2 23 SER 23 67 67 SER SER B . n B 2 24 ALA 24 68 68 ALA ALA B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 101 163 CA CA A . D 3 CA 1 102 176 CA CA A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LQC _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LQC _struct.title ;NMR solution structure of a Ca2+-Calmodulin with a binding motif (NSCaTE) peptide from the N-terminal cytoplasmic domain of the L-type Voltage-Cated Calcium Channel alpha1C subunit ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LQC _struct_keywords.pdbx_keywords 'Metal Binding Protein/Transport Protein' _struct_keywords.text 'Metal Binding Protein-Transport Protein complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP CALM_HUMAN P62158 1 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMK 2 ? 2 UNP CAC1C_HUMAN Q13936 2 GAALSWQAAIDAARQAKLMGSA 47 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LQC A 1 ? 77 ? P62158 2 ? 78 ? 1 77 2 2 2LQC B 3 ? 24 ? Q13936 47 ? 68 ? 47 68 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 2LQC GLY B 1 ? UNP Q13936 ? ? 'expression tag' 45 1 2 2LQC THR B 2 ? UNP Q13936 ? ? 'expression tag' 46 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 5 ? ASP A 20 ? THR A 5 ASP A 20 1 ? 16 HELX_P HELX_P2 2 THR A 29 ? LEU A 39 ? THR A 29 LEU A 39 1 ? 11 HELX_P HELX_P3 3 THR A 44 ? ASP A 56 ? THR A 44 ASP A 56 1 ? 13 HELX_P HELX_P4 4 ASP A 64 ? MET A 72 ? ASP A 64 MET A 72 1 ? 9 HELX_P HELX_P5 5 GLY B 3 ? GLY B 22 ? GLY B 47 GLY B 66 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 22 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 22 A CA 101 1_555 ? ? ? ? ? ? ? 3.844 ? ? metalc2 metalc ? ? A ASP 22 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 22 A CA 101 1_555 ? ? ? ? ? ? ? 3.060 ? ? metalc3 metalc ? ? A ASP 24 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 24 A CA 101 1_555 ? ? ? ? ? ? ? 2.606 ? ? metalc4 metalc ? ? A ASP 24 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 24 A CA 101 1_555 ? ? ? ? ? ? ? 2.716 ? ? metalc5 metalc ? ? A THR 26 O ? ? ? 1_555 C CA . CA ? ? A THR 26 A CA 101 1_555 ? ? ? ? ? ? ? 2.678 ? ? metalc6 metalc ? ? A THR 26 OG1 ? ? ? 1_555 C CA . CA ? ? A THR 26 A CA 101 1_555 ? ? ? ? ? ? ? 3.070 ? ? metalc7 metalc ? ? A THR 28 OG1 ? ? ? 1_555 C CA . CA ? ? A THR 28 A CA 101 1_555 ? ? ? ? ? ? ? 3.042 ? ? metalc8 metalc ? ? A GLU 31 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 31 A CA 101 1_555 ? ? ? ? ? ? ? 3.538 ? ? metalc9 metalc ? ? A GLU 31 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 31 A CA 101 1_555 ? ? ? ? ? ? ? 2.666 ? ? metalc10 metalc ? ? A THR 62 O ? ? ? 1_555 D CA . CA ? ? A THR 62 A CA 102 1_555 ? ? ? ? ? ? ? 2.964 ? ? metalc11 metalc ? ? A ASP 64 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 64 A CA 102 1_555 ? ? ? ? ? ? ? 2.860 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 34.0 ? 2 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 84.7 ? 3 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 73.8 ? 4 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 56.6 ? 5 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 72.8 ? 6 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 47.7 ? 7 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 73.0 ? 8 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 106.9 ? 9 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 104.6 ? 10 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 60.6 ? 11 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OG1 ? A THR 26 ? A THR 26 ? 1_555 112.1 ? 12 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OG1 ? A THR 26 ? A THR 26 ? 1_555 121.0 ? 13 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OG1 ? A THR 26 ? A THR 26 ? 1_555 51.4 ? 14 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OG1 ? A THR 26 ? A THR 26 ? 1_555 55.6 ? 15 O ? A THR 26 ? A THR 26 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OG1 ? A THR 26 ? A THR 26 ? 1_555 72.7 ? 16 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OG1 ? A THR 28 ? A THR 28 ? 1_555 128.4 ? 17 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OG1 ? A THR 28 ? A THR 28 ? 1_555 113.1 ? 18 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OG1 ? A THR 28 ? A THR 28 ? 1_555 132.5 ? 19 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OG1 ? A THR 28 ? A THR 28 ? 1_555 174.2 ? 20 O ? A THR 26 ? A THR 26 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OG1 ? A THR 28 ? A THR 28 ? 1_555 116.4 ? 21 OG1 ? A THR 26 ? A THR 26 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OG1 ? A THR 28 ? A THR 28 ? 1_555 119.2 ? 22 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 59.3 ? 23 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 81.1 ? 24 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 142.1 ? 25 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 98.1 ? 26 O ? A THR 26 ? A THR 26 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 56.2 ? 27 OG1 ? A THR 26 ? A THR 26 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 128.8 ? 28 OG1 ? A THR 28 ? A THR 28 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 83.4 ? 29 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 46.7 ? 30 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 49.9 ? 31 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 123.5 ? 32 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 102.8 ? 33 O ? A THR 26 ? A THR 26 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 88.8 ? 34 OG1 ? A THR 26 ? A THR 26 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 156.5 ? 35 OG1 ? A THR 28 ? A THR 28 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 81.8 ? 36 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 37.3 ? 37 O ? A THR 62 ? A THR 62 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD2 ? A ASP 64 ? A ASP 64 ? 1_555 109.6 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 27 ? THR A 28 ? ILE A 27 THR A 28 A 2 THR A 62 ? ILE A 63 ? THR A 62 ILE A 63 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 27 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 27 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 63 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 63 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 101 ? 5 'BINDING SITE FOR RESIDUE CA A 101' AC2 Software A CA 102 ? 5 'BINDING SITE FOR RESIDUE CA A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 22 ? ASP A 22 . ? 1_555 ? 2 AC1 5 ASP A 24 ? ASP A 24 . ? 1_555 ? 3 AC1 5 THR A 26 ? THR A 26 . ? 1_555 ? 4 AC1 5 THR A 28 ? THR A 28 . ? 1_555 ? 5 AC1 5 GLU A 31 ? GLU A 31 . ? 1_555 ? 6 AC2 5 ALA A 57 ? ALA A 57 . ? 1_555 ? 7 AC2 5 ASP A 58 ? ASP A 58 . ? 1_555 ? 8 AC2 5 THR A 62 ? THR A 62 . ? 1_555 ? 9 AC2 5 ASP A 64 ? ASP A 64 . ? 1_555 ? 10 AC2 5 GLU A 67 ? GLU A 67 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H1 A ALA 1 ? ? H A ASP 2 ? ? 1.31 2 6 O A GLU 45 ? ? H A GLN 49 ? ? 1.58 3 8 O A PRO 66 ? ? H A THR 70 ? ? 1.38 4 11 H3 A ALA 1 ? ? H A ASP 2 ? ? 1.34 5 13 O A PHE 19 ? ? H A LYS 21 ? ? 1.58 6 15 H2 A ALA 1 ? ? H A ASP 2 ? ? 1.23 7 20 O A ARG 37 ? ? H A GLY 40 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 20 ? ? -60.12 78.21 2 1 ASN A 42 ? ? -36.22 101.10 3 1 THR A 44 ? ? -60.46 71.32 4 1 GLU A 54 ? ? -92.84 -60.44 5 1 ASP A 56 ? ? -51.39 109.53 6 1 MET A 71 ? ? -48.63 -19.01 7 1 LYS A 75 ? ? -131.72 -143.67 8 1 MET A 76 ? ? 68.09 68.95 9 2 ASP A 2 ? ? 43.86 -101.18 10 2 LEU A 4 ? ? 42.56 -171.60 11 2 ASP A 20 ? ? -56.22 85.30 12 2 ASN A 42 ? ? -35.29 98.98 13 2 PRO A 43 ? ? -55.10 -143.18 14 2 THR A 44 ? ? 71.58 113.56 15 2 ALA A 73 ? ? -79.59 20.03 16 3 ASP A 20 ? ? -55.66 85.57 17 3 ASN A 42 ? ? -37.91 152.80 18 3 PRO A 43 ? ? -41.72 104.02 19 3 ALA A 57 ? ? 65.79 -65.76 20 3 THR A 70 ? ? -85.37 -70.83 21 3 LYS A 75 ? ? 57.75 -166.39 22 3 MET A 76 ? ? -122.37 -80.76 23 3 THR B 46 ? ? 39.67 88.82 24 3 ALA B 48 ? ? 34.66 -101.99 25 4 LEU A 4 ? ? 37.33 78.83 26 4 ASP A 20 ? ? -61.07 76.66 27 4 ASN A 42 ? ? -38.62 155.77 28 4 THR A 44 ? ? -150.79 11.67 29 4 THR A 70 ? ? -82.62 -70.52 30 4 ARG A 74 ? ? -63.46 6.81 31 4 LYS A 75 ? ? -32.66 151.33 32 5 LEU A 4 ? ? 48.03 -170.93 33 5 ASP A 20 ? ? -61.81 69.81 34 5 ASN A 42 ? ? -37.34 154.79 35 5 THR A 44 ? ? -169.82 25.20 36 5 MET A 71 ? ? -47.11 -17.13 37 5 ALA B 48 ? ? 31.37 -104.54 38 6 ASP A 20 ? ? -63.28 79.21 39 6 ASN A 42 ? ? -36.02 100.45 40 6 PRO A 43 ? ? -80.60 -95.94 41 6 THR A 44 ? ? 68.17 111.92 42 6 THR A 70 ? ? -78.75 -70.14 43 6 LYS A 75 ? ? 39.48 37.56 44 6 MET A 76 ? ? -43.20 -93.48 45 6 SER B 67 ? ? 60.83 89.87 46 7 ASP A 20 ? ? -65.32 71.33 47 7 ASN A 42 ? ? -38.02 146.04 48 7 PRO A 43 ? ? -71.13 -161.66 49 7 THR A 44 ? ? 79.88 105.12 50 7 ALA A 46 ? ? -37.51 -31.31 51 7 MET A 71 ? ? -47.98 -17.72 52 7 LYS A 75 ? ? 54.64 -90.30 53 7 MET A 76 ? ? -79.54 -148.84 54 8 LEU A 4 ? ? -59.59 -161.58 55 8 ASP A 20 ? ? -52.35 86.39 56 8 THR A 44 ? ? -61.57 71.00 57 8 ASP A 64 ? ? -72.91 -168.82 58 8 THR A 70 ? ? -47.55 -70.08 59 8 MET A 71 ? ? -49.41 -70.20 60 9 LEU A 4 ? ? 69.50 -177.59 61 9 ASP A 20 ? ? -55.15 82.28 62 9 ASN A 42 ? ? -35.03 98.45 63 9 THR A 44 ? ? -65.08 85.59 64 9 ASP A 56 ? ? -80.02 -151.96 65 9 ALA A 57 ? ? -158.11 -75.11 66 9 THR A 70 ? ? -90.76 -60.70 67 9 MET A 71 ? ? -48.02 -18.25 68 9 ARG A 74 ? ? -54.64 2.74 69 9 LYS A 75 ? ? -66.73 -175.80 70 9 SER B 67 ? ? 46.79 16.40 71 10 ASP A 20 ? ? -60.46 76.35 72 10 PRO A 43 ? ? -40.35 97.86 73 10 THR A 70 ? ? -84.34 -70.24 74 10 LYS A 75 ? ? 39.51 -145.66 75 10 THR B 46 ? ? 56.67 155.62 76 11 LEU A 4 ? ? -91.44 -147.76 77 11 ASP A 20 ? ? -54.33 84.98 78 11 ASN A 42 ? ? -36.25 101.92 79 11 ASP A 56 ? ? -75.69 -140.34 80 11 ALA A 57 ? ? -168.88 -73.29 81 11 MET A 71 ? ? -46.05 -19.96 82 11 ALA A 73 ? ? -88.82 31.35 83 11 MET A 76 ? ? 64.59 82.20 84 12 ASP A 20 ? ? -61.80 71.98 85 12 ASN A 42 ? ? -42.10 155.21 86 12 PRO A 43 ? ? -40.06 98.49 87 12 VAL A 55 ? ? -73.47 30.77 88 12 MET A 76 ? ? -39.36 113.25 89 12 ALA B 48 ? ? 32.86 -104.39 90 13 LEU A 4 ? ? -41.05 -90.67 91 13 ASP A 20 ? ? -65.47 61.72 92 13 ASN A 42 ? ? -37.04 142.43 93 13 THR A 44 ? ? -57.80 77.57 94 13 ASP A 56 ? ? -59.88 -145.36 95 13 ALA A 57 ? ? -155.38 -66.15 96 13 THR A 62 ? ? 92.28 138.13 97 13 MET A 71 ? ? -47.19 -17.05 98 14 LEU A 4 ? ? 47.28 87.29 99 14 THR A 5 ? ? -93.49 -150.80 100 14 ASP A 20 ? ? -64.01 70.58 101 14 ASN A 42 ? ? -50.13 179.39 102 14 THR A 70 ? ? -84.92 -71.30 103 14 MET A 71 ? ? -47.78 -17.62 104 14 MET A 76 ? ? -67.23 -90.36 105 14 ALA B 48 ? ? 34.02 -105.50 106 15 GLN A 3 ? ? -48.38 171.79 107 15 LEU A 4 ? ? -47.92 179.89 108 15 ASP A 20 ? ? -59.85 77.44 109 15 THR A 44 ? ? -150.70 17.28 110 15 ASN A 53 ? ? -46.84 -17.19 111 15 VAL A 55 ? ? -89.53 34.96 112 15 ALA A 57 ? ? 82.58 -61.85 113 15 THR A 70 ? ? -79.19 -70.02 114 15 MET A 71 ? ? -49.77 -18.73 115 15 MET A 76 ? ? 60.83 99.87 116 15 SER B 67 ? ? 43.18 82.24 117 16 ASP A 20 ? ? -66.96 68.34 118 16 SER A 38 ? ? -48.84 -18.53 119 16 ASN A 42 ? ? -116.44 77.72 120 16 VAL A 55 ? ? -98.33 -67.27 121 16 ASP A 56 ? ? 30.67 -138.07 122 16 ALA A 57 ? ? -173.20 -71.55 123 16 LYS A 75 ? ? -173.26 93.18 124 17 GLN A 3 ? ? -52.91 174.77 125 17 LEU A 4 ? ? -60.88 -75.11 126 17 ASP A 20 ? ? -59.86 76.66 127 17 ASN A 42 ? ? -42.76 153.85 128 17 THR A 44 ? ? -156.98 14.48 129 17 VAL A 55 ? ? -62.46 4.72 130 17 THR A 70 ? ? -85.01 -71.68 131 17 LYS A 75 ? ? -61.61 -171.03 132 17 THR B 46 ? ? 41.40 76.04 133 18 LEU A 4 ? ? -56.00 175.60 134 18 ASP A 20 ? ? -60.83 82.90 135 18 ASN A 42 ? ? -36.68 104.00 136 18 THR A 44 ? ? -51.80 105.62 137 18 ALA A 46 ? ? -38.44 -36.98 138 18 THR A 62 ? ? 96.91 166.06 139 18 MET A 71 ? ? -46.91 -18.76 140 18 THR B 46 ? ? -143.25 -43.70 141 19 ASP A 2 ? ? 53.26 173.23 142 19 LEU A 4 ? ? 42.73 -171.60 143 19 THR A 5 ? ? 179.99 179.05 144 19 ASP A 20 ? ? -52.66 84.90 145 19 ASN A 42 ? ? -34.48 96.51 146 19 PRO A 43 ? ? -56.00 -8.75 147 19 THR A 44 ? ? -48.39 83.17 148 19 GLU A 45 ? ? -57.22 -7.68 149 19 MET A 76 ? ? 75.40 -151.84 150 19 SER B 67 ? ? 53.21 168.88 151 20 LEU A 4 ? ? 78.01 179.64 152 20 ASP A 20 ? ? -66.69 62.82 153 20 ASN A 42 ? ? -46.93 155.59 154 20 THR A 44 ? ? -167.13 16.45 155 20 THR A 62 ? ? 100.38 140.85 156 20 LYS A 75 ? ? -89.09 32.71 157 20 MET A 76 ? ? 48.07 -89.09 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LQC _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LQC _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 13C; U-100% 15N] calmodulin, 2 mM NSCaTE peptide, 55 M H2O, 5 M [U-99% 2H] D2O, 10 mM DTT, 20 mM TRIS, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' ;1 mM [U-100% 13C; U-100% 15N] NSCaTE peptide, 0.5 mM calmodulin, 55 M H2O, 5 M [U-99% 2H] D2O, 10 mM DTT, 20 mM TRIS, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' '1 mM [U-100% 13C; U-100% 15N] calmodulin, 2 mM NSCaTE peptide, 7.5 mg Pf1 phage, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id calmodulin-1 1 ? mM '[U-100% 13C; U-100% 15N]' 1 'NSCaTE peptide-2' 2 ? mM ? 1 H2O-3 55 ? M ? 1 D2O-4 5 ? M '[U-99% 2H]' 1 DTT-5 10 ? mM ? 1 TRIS-6 20 ? mM ? 1 'NSCaTE peptide-7' 1 ? mM '[U-100% 13C; U-100% 15N]' 2 calmodulin-8 0.5 ? mM ? 2 H2O-9 55 ? M ? 2 D2O-10 5 ? M '[U-99% 2H]' 2 DTT-11 10 ? mM ? 2 TRIS-12 20 ? mM ? 2 calmodulin-13 1 ? mM '[U-100% 13C; U-100% 15N]' 3 'NSCaTE peptide-14' 2 ? mM ? 3 'Pf1 phage-15' 7.5 ? mg/mL ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCACB' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HCACO' 1 6 1 '3D C(CO)NH' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D HBHA(CO)NH' 1 9 1 '3D H(CCO)NH' 1 10 1 '3D 1H-13C NOESY aliphatic' 1 11 1 '3D 1H-15N NOESY' 1 12 2 '2D 1H-15N HSQC' 1 13 2 '3D HNCACB' 1 14 2 '3D CBCA(CO)NH' 1 15 2 '3D HNCO' 1 16 2 '3D HCACO' 1 17 2 '3D C(CO)NH' 1 18 2 '3D HCCH-TOCSY' 1 19 2 '3D HBHA(CO)NH' 1 20 2 '3D H(CCO)NH' 1 21 2 '3D 1H-13C NOESY aliphatic' 1 22 2 '3D 1H-15N NOESY' 1 23 3 '2D 1H-15N HSQC' # _pdbx_nmr_refine.entry_id 2LQC _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 3 'Johnson, One Moon Scientific' 'peak picking' NMRView ? 4 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 5 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 6 'Bruker Biospin' collection XwinNMR ? 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 ILE N N N N 124 ILE CA C N S 125 ILE C C N N 126 ILE O O N N 127 ILE CB C N S 128 ILE CG1 C N N 129 ILE CG2 C N N 130 ILE CD1 C N N 131 ILE OXT O N N 132 ILE H H N N 133 ILE H2 H N N 134 ILE HA H N N 135 ILE HB H N N 136 ILE HG12 H N N 137 ILE HG13 H N N 138 ILE HG21 H N N 139 ILE HG22 H N N 140 ILE HG23 H N N 141 ILE HD11 H N N 142 ILE HD12 H N N 143 ILE HD13 H N N 144 ILE HXT H N N 145 LEU N N N N 146 LEU CA C N S 147 LEU C C N N 148 LEU O O N N 149 LEU CB C N N 150 LEU CG C N N 151 LEU CD1 C N N 152 LEU CD2 C N N 153 LEU OXT O N N 154 LEU H H N N 155 LEU H2 H N N 156 LEU HA H N N 157 LEU HB2 H N N 158 LEU HB3 H N N 159 LEU HG H N N 160 LEU HD11 H N N 161 LEU HD12 H N N 162 LEU HD13 H N N 163 LEU HD21 H N N 164 LEU HD22 H N N 165 LEU HD23 H N N 166 LEU HXT H N N 167 LYS N N N N 168 LYS CA C N S 169 LYS C C N N 170 LYS O O N N 171 LYS CB C N N 172 LYS CG C N N 173 LYS CD C N N 174 LYS CE C N N 175 LYS NZ N N N 176 LYS OXT O N N 177 LYS H H N N 178 LYS H2 H N N 179 LYS HA H N N 180 LYS HB2 H N N 181 LYS HB3 H N N 182 LYS HG2 H N N 183 LYS HG3 H N N 184 LYS HD2 H N N 185 LYS HD3 H N N 186 LYS HE2 H N N 187 LYS HE3 H N N 188 LYS HZ1 H N N 189 LYS HZ2 H N N 190 LYS HZ3 H N N 191 LYS HXT H N N 192 MET N N N N 193 MET CA C N S 194 MET C C N N 195 MET O O N N 196 MET CB C N N 197 MET CG C N N 198 MET SD S N N 199 MET CE C N N 200 MET OXT O N N 201 MET H H N N 202 MET H2 H N N 203 MET HA H N N 204 MET HB2 H N N 205 MET HB3 H N N 206 MET HG2 H N N 207 MET HG3 H N N 208 MET HE1 H N N 209 MET HE2 H N N 210 MET HE3 H N N 211 MET HXT H N N 212 PHE N N N N 213 PHE CA C N S 214 PHE C C N N 215 PHE O O N N 216 PHE CB C N N 217 PHE CG C Y N 218 PHE CD1 C Y N 219 PHE CD2 C Y N 220 PHE CE1 C Y N 221 PHE CE2 C Y N 222 PHE CZ C Y N 223 PHE OXT O N N 224 PHE H H N N 225 PHE H2 H N N 226 PHE HA H N N 227 PHE HB2 H N N 228 PHE HB3 H N N 229 PHE HD1 H N N 230 PHE HD2 H N N 231 PHE HE1 H N N 232 PHE HE2 H N N 233 PHE HZ H N N 234 PHE HXT H N N 235 PRO N N N N 236 PRO CA C N S 237 PRO C C N N 238 PRO O O N N 239 PRO CB C N N 240 PRO CG C N N 241 PRO CD C N N 242 PRO OXT O N N 243 PRO H H N N 244 PRO HA H N N 245 PRO HB2 H N N 246 PRO HB3 H N N 247 PRO HG2 H N N 248 PRO HG3 H N N 249 PRO HD2 H N N 250 PRO HD3 H N N 251 PRO HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 TRP N N N N 284 TRP CA C N S 285 TRP C C N N 286 TRP O O N N 287 TRP CB C N N 288 TRP CG C Y N 289 TRP CD1 C Y N 290 TRP CD2 C Y N 291 TRP NE1 N Y N 292 TRP CE2 C Y N 293 TRP CE3 C Y N 294 TRP CZ2 C Y N 295 TRP CZ3 C Y N 296 TRP CH2 C Y N 297 TRP OXT O N N 298 TRP H H N N 299 TRP H2 H N N 300 TRP HA H N N 301 TRP HB2 H N N 302 TRP HB3 H N N 303 TRP HD1 H N N 304 TRP HE1 H N N 305 TRP HE3 H N N 306 TRP HZ2 H N N 307 TRP HZ3 H N N 308 TRP HH2 H N N 309 TRP HXT H N N 310 VAL N N N N 311 VAL CA C N S 312 VAL C C N N 313 VAL O O N N 314 VAL CB C N N 315 VAL CG1 C N N 316 VAL CG2 C N N 317 VAL OXT O N N 318 VAL H H N N 319 VAL H2 H N N 320 VAL HA H N N 321 VAL HB H N N 322 VAL HG11 H N N 323 VAL HG12 H N N 324 VAL HG13 H N N 325 VAL HG21 H N N 326 VAL HG22 H N N 327 VAL HG23 H N N 328 VAL HXT H N N 329 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TRP N CA sing N N 270 TRP N H sing N N 271 TRP N H2 sing N N 272 TRP CA C sing N N 273 TRP CA CB sing N N 274 TRP CA HA sing N N 275 TRP C O doub N N 276 TRP C OXT sing N N 277 TRP CB CG sing N N 278 TRP CB HB2 sing N N 279 TRP CB HB3 sing N N 280 TRP CG CD1 doub Y N 281 TRP CG CD2 sing Y N 282 TRP CD1 NE1 sing Y N 283 TRP CD1 HD1 sing N N 284 TRP CD2 CE2 doub Y N 285 TRP CD2 CE3 sing Y N 286 TRP NE1 CE2 sing Y N 287 TRP NE1 HE1 sing N N 288 TRP CE2 CZ2 sing Y N 289 TRP CE3 CZ3 doub Y N 290 TRP CE3 HE3 sing N N 291 TRP CZ2 CH2 doub Y N 292 TRP CZ2 HZ2 sing N N 293 TRP CZ3 CH2 sing Y N 294 TRP CZ3 HZ3 sing N N 295 TRP CH2 HH2 sing N N 296 TRP OXT HXT sing N N 297 VAL N CA sing N N 298 VAL N H sing N N 299 VAL N H2 sing N N 300 VAL CA C sing N N 301 VAL CA CB sing N N 302 VAL CA HA sing N N 303 VAL C O doub N N 304 VAL C OXT sing N N 305 VAL CB CG1 sing N N 306 VAL CB CG2 sing N N 307 VAL CB HB sing N N 308 VAL CG1 HG11 sing N N 309 VAL CG1 HG12 sing N N 310 VAL CG1 HG13 sing N N 311 VAL CG2 HG21 sing N N 312 VAL CG2 HG22 sing N N 313 VAL CG2 HG23 sing N N 314 VAL OXT HXT sing N N 315 # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2LQC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ #