data_2LQO # _entry.id 2LQO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LQO pdb_00002lqo 10.2210/pdb2lqo/pdb RCSB RCSB102712 ? ? BMRB 18322 ? ? WWPDB D_1000102712 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 18325 BMRB 'Oxidized Mrx1' unspecified 2lqq PDB 'Oxidized Mrx1' unspecified 18322 BMRB 'Reduced Mrx1' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LQO _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-03-10 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Buts, L.' 1 'Van Laer, K.' 2 'Messens, J.' 3 # _citation.id primary _citation.title 'Mycoredoxin-1 is one of the missing links in the oxidative stress defence mechanism of Mycobacteria.' _citation.journal_abbrev Mol.Microbiol. _citation.journal_volume 86 _citation.page_first 787 _citation.page_last 804 _citation.year 2012 _citation.journal_id_ASTM MOMIEE _citation.country UK _citation.journal_id_ISSN 0950-382X _citation.journal_id_CSD 2007 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22970802 _citation.pdbx_database_id_DOI 10.1111/mmi.12030 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Van Laer, K.' 1 ? primary 'Buts, L.' 2 ? primary 'Foloppe, N.' 3 ? primary 'Vertommen, D.' 4 ? primary 'Van Belle, K.' 5 ? primary 'Wahni, K.' 6 ? primary 'Roos, G.' 7 ? primary 'Nilsson, L.' 8 ? primary 'Mateos, L.M.' 9 ? primary 'Rawat, M.' 10 ? primary 'van Nuland, N.A.' 11 ? primary 'Messens, J.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative glutaredoxin Rv3198.1/MT3292' _entity.formula_weight 10030.316 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 1.-.-.- _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVTAALTIYTTSWCGYCLRLKTALTANRIAYDEVDIEHNRAAAEFVGSVNGGNRTVPTVKFADGSTLTNPSADEVKAKLV KIAGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVTAALTIYTTSWCGYCLRLKTALTANRIAYDEVDIEHNRAAAEFVGSVNGGNRTVPTVKFADGSTLTNPSADEVKAKLV KIAGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 THR n 1 4 ALA n 1 5 ALA n 1 6 LEU n 1 7 THR n 1 8 ILE n 1 9 TYR n 1 10 THR n 1 11 THR n 1 12 SER n 1 13 TRP n 1 14 CYS n 1 15 GLY n 1 16 TYR n 1 17 CYS n 1 18 LEU n 1 19 ARG n 1 20 LEU n 1 21 LYS n 1 22 THR n 1 23 ALA n 1 24 LEU n 1 25 THR n 1 26 ALA n 1 27 ASN n 1 28 ARG n 1 29 ILE n 1 30 ALA n 1 31 TYR n 1 32 ASP n 1 33 GLU n 1 34 VAL n 1 35 ASP n 1 36 ILE n 1 37 GLU n 1 38 HIS n 1 39 ASN n 1 40 ARG n 1 41 ALA n 1 42 ALA n 1 43 ALA n 1 44 GLU n 1 45 PHE n 1 46 VAL n 1 47 GLY n 1 48 SER n 1 49 VAL n 1 50 ASN n 1 51 GLY n 1 52 GLY n 1 53 ASN n 1 54 ARG n 1 55 THR n 1 56 VAL n 1 57 PRO n 1 58 THR n 1 59 VAL n 1 60 LYS n 1 61 PHE n 1 62 ALA n 1 63 ASP n 1 64 GLY n 1 65 SER n 1 66 THR n 1 67 LEU n 1 68 THR n 1 69 ASN n 1 70 PRO n 1 71 SER n 1 72 ALA n 1 73 ASP n 1 74 GLU n 1 75 VAL n 1 76 LYS n 1 77 ALA n 1 78 LYS n 1 79 LEU n 1 80 VAL n 1 81 LYS n 1 82 ILE n 1 83 ALA n 1 84 GLY n 1 85 LEU n 1 86 GLU n 1 87 HIS n 1 88 HIS n 1 89 HIS n 1 90 HIS n 1 91 HIS n 1 92 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Rv3198.1, MT3292, Rv3198A' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET28a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y3198_MYCTU _struct_ref.pdbx_db_accession Q8VJ51 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MITAALTIYTTSWCGYCLRLKTALTANRIAYDEVDIEHNRAAAEFVGSVNGGNRTVPTVKFADGSTLTNPSADEVKAKLV KIAG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LQO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 84 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8VJ51 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 84 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 84 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LQO VAL A 2 ? UNP Q8VJ51 ILE 2 conflict 2 1 1 2LQO LEU A 85 ? UNP Q8VJ51 ? ? 'expression tag' 85 2 1 2LQO GLU A 86 ? UNP Q8VJ51 ? ? 'expression tag' 86 3 1 2LQO HIS A 87 ? UNP Q8VJ51 ? ? 'expression tag' 87 4 1 2LQO HIS A 88 ? UNP Q8VJ51 ? ? 'expression tag' 88 5 1 2LQO HIS A 89 ? UNP Q8VJ51 ? ? 'expression tag' 89 6 1 2LQO HIS A 90 ? UNP Q8VJ51 ? ? 'expression tag' 90 7 1 2LQO HIS A 91 ? UNP Q8VJ51 ? ? 'expression tag' 91 8 1 2LQO HIS A 92 ? UNP Q8VJ51 ? ? 'expression tag' 92 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCO' 1 6 1 '3D HNCACB' 1 7 1 '3D HBHA(CO)NH' 1 8 1 '3D C(CO)NH' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '3D 1H-13C NOESY' 1 12 1 HBCBCGCDHD 1 13 1 HBCBCGCDCEHE # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 6.6 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.8-1.0 mM [U-99% 13C; U-99% 15N] protein, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian ? 1 'Varian Varian NMR Systems' 800 Varian ? 2 'Varian Varian NMR Systems' # _pdbx_nmr_refine.entry_id 2LQO _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LQO _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LQO _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 2 CCPN 'chemical shift assignment' CCPNMR ? 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 4 'Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS ? 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LQO _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LQO _struct.title 'Mrx1 reduced' _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LQO _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'Trx fold, OXIDOREDUCTASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 16 ? ASN A 27 ? TYR A 16 ASN A 27 1 ? 12 HELX_P HELX_P2 2 ASN A 39 ? ASN A 50 ? ASN A 39 ASN A 50 1 ? 12 HELX_P HELX_P3 3 SER A 71 ? GLY A 84 ? SER A 71 GLY A 84 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 32 ? ASP A 35 ? ASP A 32 ASP A 35 A 2 LEU A 6 ? THR A 10 ? LEU A 6 THR A 10 A 3 THR A 58 ? PHE A 61 ? THR A 58 PHE A 61 A 4 THR A 66 ? THR A 68 ? THR A 66 THR A 68 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASP A 32 ? O ASP A 32 N ILE A 8 ? N ILE A 8 A 2 3 N TYR A 9 ? N TYR A 9 O THR A 58 ? O THR A 58 A 3 4 N VAL A 59 ? N VAL A 59 O LEU A 67 ? O LEU A 67 # _atom_sites.entry_id 2LQO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 HIS 89 89 ? ? ? A . n A 1 90 HIS 90 90 ? ? ? A . n A 1 91 HIS 91 91 ? ? ? A . n A 1 92 HIS 92 92 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-10-03 2 'Structure model' 1 1 2013-01-30 3 'Structure model' 1 2 2013-03-06 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_exptl_sample.component entity-1 _pdbx_nmr_exptl_sample.concentration ? _pdbx_nmr_exptl_sample.concentration_range 0.8-1.0 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LQO _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1872 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 394 _pdbx_nmr_constraints.NOE_long_range_total_count 602 _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 74 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 73 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 HZ2 A LYS 21 ? ? OE1 A GLU 33 ? ? 1.57 2 6 HZ1 A LYS 81 ? ? OE2 A GLU 86 ? ? 1.58 3 11 O A CYS 14 ? ? HG A CYS 17 ? ? 1.58 4 16 O A CYS 14 ? ? HG A CYS 17 ? ? 1.59 5 16 HG A CYS 14 ? ? O A THR 55 ? ? 1.60 6 20 HZ2 A LYS 76 ? ? O A HIS 88 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 2 ? ? 51.39 18.98 2 1 THR A 55 ? ? -156.16 -39.75 3 1 ASN A 69 ? ? -4.69 88.16 4 1 LEU A 85 ? ? 70.48 -50.82 5 1 HIS A 87 ? ? -174.65 -177.25 6 2 VAL A 2 ? ? 73.32 99.19 7 2 ARG A 54 ? ? -54.21 101.10 8 2 THR A 55 ? ? -146.66 -15.96 9 2 ASN A 69 ? ? -6.07 86.95 10 3 SER A 12 ? ? -46.32 -17.46 11 3 THR A 55 ? ? -155.97 -25.27 12 3 ASN A 69 ? ? -6.75 83.11 13 3 LEU A 85 ? ? -130.33 -77.02 14 3 HIS A 87 ? ? -145.94 -56.05 15 4 ARG A 54 ? ? -64.27 54.37 16 4 ASN A 69 ? ? -5.32 83.01 17 5 VAL A 2 ? ? -65.12 84.05 18 5 THR A 55 ? ? -146.79 -26.86 19 5 ASN A 69 ? ? -4.87 86.95 20 5 GLU A 86 ? ? 67.88 119.97 21 6 THR A 55 ? ? -154.83 -29.86 22 6 ASN A 69 ? ? -5.46 84.24 23 7 ALA A 5 ? ? -96.93 -60.17 24 7 THR A 55 ? ? -157.47 -33.39 25 7 ASN A 69 ? ? -5.48 90.87 26 8 THR A 55 ? ? -162.33 -26.66 27 8 ASN A 69 ? ? -5.75 87.81 28 8 LEU A 85 ? ? -81.76 -70.14 29 9 SER A 12 ? ? -48.82 -18.35 30 9 THR A 55 ? ? -149.37 -34.76 31 9 ASN A 69 ? ? -5.89 91.62 32 9 GLU A 86 ? ? 63.30 -169.44 33 10 ASN A 69 ? ? -5.03 92.16 34 10 LEU A 85 ? ? 41.33 -87.84 35 10 HIS A 87 ? ? 162.72 -45.31 36 11 VAL A 2 ? ? 66.04 -91.49 37 11 THR A 3 ? ? 173.48 -45.10 38 11 ALA A 5 ? ? -104.92 -64.43 39 11 THR A 55 ? ? -157.93 -8.08 40 11 ASN A 69 ? ? -5.11 85.35 41 11 GLU A 86 ? ? 62.41 81.35 42 12 ALA A 4 ? ? -112.67 77.93 43 12 THR A 55 ? ? -149.67 -17.89 44 12 ASN A 69 ? ? -5.49 88.39 45 13 ASN A 69 ? ? -5.53 83.27 46 14 THR A 55 ? ? -145.77 -32.54 47 14 ASN A 69 ? ? -5.13 84.70 48 14 LEU A 85 ? ? -118.07 -71.56 49 14 HIS A 87 ? ? 72.75 -51.39 50 15 ALA A 5 ? ? -100.82 -64.19 51 15 THR A 55 ? ? -166.73 -25.62 52 15 ASN A 69 ? ? -5.18 89.67 53 16 ASN A 69 ? ? -5.98 84.24 54 17 ASN A 69 ? ? -4.64 85.81 55 17 HIS A 87 ? ? 62.69 77.43 56 18 THR A 55 ? ? -161.22 -30.63 57 18 ASN A 69 ? ? -5.36 84.83 58 18 LEU A 85 ? ? 58.20 -77.98 59 19 ARG A 28 ? ? 64.38 61.73 60 19 THR A 55 ? ? -163.81 -31.44 61 19 ASN A 69 ? ? -4.76 84.85 62 19 LEU A 85 ? ? 68.70 -71.12 63 19 HIS A 87 ? ? 68.67 99.31 64 20 SER A 12 ? ? -58.53 -8.41 65 20 THR A 55 ? ? -162.70 -34.26 66 20 ASN A 69 ? ? -5.69 86.38 67 20 LEU A 85 ? ? -128.73 -83.01 68 20 GLU A 86 ? ? 45.55 87.03 69 20 HIS A 87 ? ? -172.29 -44.99 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 7 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 54 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.088 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 89 ? A HIS 89 2 1 Y 1 A HIS 90 ? A HIS 90 3 1 Y 1 A HIS 91 ? A HIS 91 4 1 Y 1 A HIS 92 ? A HIS 92 5 2 Y 1 A HIS 89 ? A HIS 89 6 2 Y 1 A HIS 90 ? A HIS 90 7 2 Y 1 A HIS 91 ? A HIS 91 8 2 Y 1 A HIS 92 ? A HIS 92 9 3 Y 1 A HIS 89 ? A HIS 89 10 3 Y 1 A HIS 90 ? A HIS 90 11 3 Y 1 A HIS 91 ? A HIS 91 12 3 Y 1 A HIS 92 ? A HIS 92 13 4 Y 1 A HIS 89 ? A HIS 89 14 4 Y 1 A HIS 90 ? A HIS 90 15 4 Y 1 A HIS 91 ? A HIS 91 16 4 Y 1 A HIS 92 ? A HIS 92 17 5 Y 1 A HIS 89 ? A HIS 89 18 5 Y 1 A HIS 90 ? A HIS 90 19 5 Y 1 A HIS 91 ? A HIS 91 20 5 Y 1 A HIS 92 ? A HIS 92 21 6 Y 1 A HIS 89 ? A HIS 89 22 6 Y 1 A HIS 90 ? A HIS 90 23 6 Y 1 A HIS 91 ? A HIS 91 24 6 Y 1 A HIS 92 ? A HIS 92 25 7 Y 1 A HIS 89 ? A HIS 89 26 7 Y 1 A HIS 90 ? A HIS 90 27 7 Y 1 A HIS 91 ? A HIS 91 28 7 Y 1 A HIS 92 ? A HIS 92 29 8 Y 1 A HIS 89 ? A HIS 89 30 8 Y 1 A HIS 90 ? A HIS 90 31 8 Y 1 A HIS 91 ? A HIS 91 32 8 Y 1 A HIS 92 ? A HIS 92 33 9 Y 1 A HIS 89 ? A HIS 89 34 9 Y 1 A HIS 90 ? A HIS 90 35 9 Y 1 A HIS 91 ? A HIS 91 36 9 Y 1 A HIS 92 ? A HIS 92 37 10 Y 1 A HIS 89 ? A HIS 89 38 10 Y 1 A HIS 90 ? A HIS 90 39 10 Y 1 A HIS 91 ? A HIS 91 40 10 Y 1 A HIS 92 ? A HIS 92 41 11 Y 1 A HIS 89 ? A HIS 89 42 11 Y 1 A HIS 90 ? A HIS 90 43 11 Y 1 A HIS 91 ? A HIS 91 44 11 Y 1 A HIS 92 ? A HIS 92 45 12 Y 1 A HIS 89 ? A HIS 89 46 12 Y 1 A HIS 90 ? A HIS 90 47 12 Y 1 A HIS 91 ? A HIS 91 48 12 Y 1 A HIS 92 ? A HIS 92 49 13 Y 1 A HIS 89 ? A HIS 89 50 13 Y 1 A HIS 90 ? A HIS 90 51 13 Y 1 A HIS 91 ? A HIS 91 52 13 Y 1 A HIS 92 ? A HIS 92 53 14 Y 1 A HIS 89 ? A HIS 89 54 14 Y 1 A HIS 90 ? A HIS 90 55 14 Y 1 A HIS 91 ? A HIS 91 56 14 Y 1 A HIS 92 ? A HIS 92 57 15 Y 1 A HIS 89 ? A HIS 89 58 15 Y 1 A HIS 90 ? A HIS 90 59 15 Y 1 A HIS 91 ? A HIS 91 60 15 Y 1 A HIS 92 ? A HIS 92 61 16 Y 1 A HIS 89 ? A HIS 89 62 16 Y 1 A HIS 90 ? A HIS 90 63 16 Y 1 A HIS 91 ? A HIS 91 64 16 Y 1 A HIS 92 ? A HIS 92 65 17 Y 1 A HIS 89 ? A HIS 89 66 17 Y 1 A HIS 90 ? A HIS 90 67 17 Y 1 A HIS 91 ? A HIS 91 68 17 Y 1 A HIS 92 ? A HIS 92 69 18 Y 1 A HIS 89 ? A HIS 89 70 18 Y 1 A HIS 90 ? A HIS 90 71 18 Y 1 A HIS 91 ? A HIS 91 72 18 Y 1 A HIS 92 ? A HIS 92 73 19 Y 1 A HIS 89 ? A HIS 89 74 19 Y 1 A HIS 90 ? A HIS 90 75 19 Y 1 A HIS 91 ? A HIS 91 76 19 Y 1 A HIS 92 ? A HIS 92 77 20 Y 1 A HIS 89 ? A HIS 89 78 20 Y 1 A HIS 90 ? A HIS 90 79 20 Y 1 A HIS 91 ? A HIS 91 80 20 Y 1 A HIS 92 ? A HIS 92 #