data_2LQP # _entry.id 2LQP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LQP pdb_00002lqp 10.2210/pdb2lqp/pdb RCSB RCSB102713 ? ? BMRB 18323 ? 10.13018/BMR18323 WWPDB D_1000102713 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-06-06 2 'Structure model' 1 1 2012-06-13 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' pdbx_struct_conn_angle 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_site 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond 10 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.value' 19 3 'Structure model' '_struct_conn.pdbx_dist_value' 20 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 21 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 22 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 3 'Structure model' '_struct_site.pdbx_auth_seq_id' 30 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LQP _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-03-10 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 18323 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, Z.' 1 'Vogel, H.J.' 2 # _citation.id primary _citation.title ;Structural basis for the regulation of L-type voltage-gated calcium channels: interactions between the N-terminal cytoplasmic domain and Ca(2+)-calmodulin. ; _citation.journal_abbrev 'Front Mol Neurosci' _citation.journal_volume 5 _citation.page_first 38 _citation.page_last 38 _citation.year 2012 _citation.journal_id_ASTM ? _citation.country CH _citation.journal_id_ISSN 1662-5099 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22518098 _citation.pdbx_database_id_DOI 10.3389/fnmol.2012.00038 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, Z.' 1 ? primary 'Vogel, H.J.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Calmodulin 8155.828 1 ? ? 'EF-hands 3 and 4' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name CaM # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK _entity_poly.pdbx_seq_one_letter_code_can DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 THR n 1 3 ASP n 1 4 SER n 1 5 GLU n 1 6 GLU n 1 7 GLU n 1 8 ILE n 1 9 ARG n 1 10 GLU n 1 11 ALA n 1 12 PHE n 1 13 ARG n 1 14 VAL n 1 15 PHE n 1 16 ASP n 1 17 LYS n 1 18 ASP n 1 19 GLY n 1 20 ASN n 1 21 GLY n 1 22 TYR n 1 23 ILE n 1 24 SER n 1 25 ALA n 1 26 ALA n 1 27 GLU n 1 28 LEU n 1 29 ARG n 1 30 HIS n 1 31 VAL n 1 32 MET n 1 33 THR n 1 34 ASN n 1 35 LEU n 1 36 GLY n 1 37 GLU n 1 38 LYS n 1 39 LEU n 1 40 THR n 1 41 ASP n 1 42 GLU n 1 43 GLU n 1 44 VAL n 1 45 ASP n 1 46 GLU n 1 47 MET n 1 48 ILE n 1 49 ARG n 1 50 GLU n 1 51 ALA n 1 52 ASP n 1 53 ILE n 1 54 ASP n 1 55 GLY n 1 56 ASP n 1 57 GLY n 1 58 GLN n 1 59 VAL n 1 60 ASN n 1 61 TYR n 1 62 GLU n 1 63 GLU n 1 64 PHE n 1 65 VAL n 1 66 GLN n 1 67 MET n 1 68 MET n 1 69 THR n 1 70 ALA n 1 71 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CALM1, CALM, CAM, CAM1, CALM2, CAM2, CAMB, CALM3, CALML2, CAM3, CAMC, CAMIII' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET30b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 78 78 ASP ASP A . n A 1 2 THR 2 79 79 THR THR A . n A 1 3 ASP 3 80 80 ASP ASP A . n A 1 4 SER 4 81 81 SER SER A . n A 1 5 GLU 5 82 82 GLU GLU A . n A 1 6 GLU 6 83 83 GLU GLU A . n A 1 7 GLU 7 84 84 GLU GLU A . n A 1 8 ILE 8 85 85 ILE ILE A . n A 1 9 ARG 9 86 86 ARG ARG A . n A 1 10 GLU 10 87 87 GLU GLU A . n A 1 11 ALA 11 88 88 ALA ALA A . n A 1 12 PHE 12 89 89 PHE PHE A . n A 1 13 ARG 13 90 90 ARG ARG A . n A 1 14 VAL 14 91 91 VAL VAL A . n A 1 15 PHE 15 92 92 PHE PHE A . n A 1 16 ASP 16 93 93 ASP ASP A . n A 1 17 LYS 17 94 94 LYS LYS A . n A 1 18 ASP 18 95 95 ASP ASP A . n A 1 19 GLY 19 96 96 GLY GLY A . n A 1 20 ASN 20 97 97 ASN ASN A . n A 1 21 GLY 21 98 98 GLY GLY A . n A 1 22 TYR 22 99 99 TYR TYR A . n A 1 23 ILE 23 100 100 ILE ILE A . n A 1 24 SER 24 101 101 SER SER A . n A 1 25 ALA 25 102 102 ALA ALA A . n A 1 26 ALA 26 103 103 ALA ALA A . n A 1 27 GLU 27 104 104 GLU GLU A . n A 1 28 LEU 28 105 105 LEU LEU A . n A 1 29 ARG 29 106 106 ARG ARG A . n A 1 30 HIS 30 107 107 HIS HIS A . n A 1 31 VAL 31 108 108 VAL VAL A . n A 1 32 MET 32 109 109 MET MET A . n A 1 33 THR 33 110 110 THR THR A . n A 1 34 ASN 34 111 111 ASN ASN A . n A 1 35 LEU 35 112 112 LEU LEU A . n A 1 36 GLY 36 113 113 GLY GLY A . n A 1 37 GLU 37 114 114 GLU GLU A . n A 1 38 LYS 38 115 115 LYS LYS A . n A 1 39 LEU 39 116 116 LEU LEU A . n A 1 40 THR 40 117 117 THR THR A . n A 1 41 ASP 41 118 118 ASP ASP A . n A 1 42 GLU 42 119 119 GLU GLU A . n A 1 43 GLU 43 120 120 GLU GLU A . n A 1 44 VAL 44 121 121 VAL VAL A . n A 1 45 ASP 45 122 122 ASP ASP A . n A 1 46 GLU 46 123 123 GLU GLU A . n A 1 47 MET 47 124 124 MET MET A . n A 1 48 ILE 48 125 125 ILE ILE A . n A 1 49 ARG 49 126 126 ARG ARG A . n A 1 50 GLU 50 127 127 GLU GLU A . n A 1 51 ALA 51 128 128 ALA ALA A . n A 1 52 ASP 52 129 129 ASP ASP A . n A 1 53 ILE 53 130 130 ILE ILE A . n A 1 54 ASP 54 131 131 ASP ASP A . n A 1 55 GLY 55 132 132 GLY GLY A . n A 1 56 ASP 56 133 133 ASP ASP A . n A 1 57 GLY 57 134 134 GLY GLY A . n A 1 58 GLN 58 135 135 GLN GLN A . n A 1 59 VAL 59 136 136 VAL VAL A . n A 1 60 ASN 60 137 137 ASN ASN A . n A 1 61 TYR 61 138 138 TYR TYR A . n A 1 62 GLU 62 139 139 GLU GLU A . n A 1 63 GLU 63 140 140 GLU GLU A . n A 1 64 PHE 64 141 141 PHE PHE A . n A 1 65 VAL 65 142 142 VAL VAL A . n A 1 66 GLN 66 143 143 GLN GLN A . n A 1 67 MET 67 144 144 MET MET A . n A 1 68 MET 68 145 145 MET MET A . n A 1 69 THR 69 146 146 THR THR A . n A 1 70 ALA 70 147 147 ALA ALA A . n A 1 71 LYS 71 148 148 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 179 CA CA A . C 2 CA 1 202 192 CA CA A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LQP _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LQP _struct.title ;NMR solution structure of the Ca2+-Calmodulin C-terminal domain in a complex with a peptide (NSCaTE) from the L-type Voltage-Gated Calcium Channel alpha1C subunit ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LQP _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'NSCaTE, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CALM_HUMAN _struct_ref.pdbx_db_accession P62158 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK _struct_ref.pdbx_align_begin 79 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LQP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 71 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62158 _struct_ref_seq.db_align_beg 79 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 149 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 78 _struct_ref_seq.pdbx_auth_seq_align_end 148 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 4 ? ASP A 16 ? SER A 81 ASP A 93 1 ? 13 HELX_P HELX_P2 2 SER A 24 ? GLY A 36 ? SER A 101 GLY A 113 1 ? 13 HELX_P HELX_P3 3 THR A 40 ? ALA A 51 ? THR A 117 ALA A 128 1 ? 12 HELX_P HELX_P4 4 TYR A 61 ? ALA A 70 ? TYR A 138 ALA A 147 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 16 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 93 A CA 201 1_555 ? ? ? ? ? ? ? 3.040 ? ? metalc2 metalc ? ? A ASN 20 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 97 A CA 201 1_555 ? ? ? ? ? ? ? 2.685 ? ? metalc3 metalc ? ? A TYR 22 O ? ? ? 1_555 B CA . CA ? ? A TYR 99 A CA 201 1_555 ? ? ? ? ? ? ? 2.926 ? ? metalc4 metalc ? ? A GLU 27 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 104 A CA 201 1_555 ? ? ? ? ? ? ? 3.073 ? ? metalc5 metalc ? ? A GLU 27 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 104 A CA 201 1_555 ? ? ? ? ? ? ? 2.828 ? ? metalc6 metalc ? ? A ASP 52 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 129 A CA 202 1_555 ? ? ? ? ? ? ? 2.606 ? ? metalc7 metalc ? ? A ASP 52 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 129 A CA 202 1_555 ? ? ? ? ? ? ? 3.136 ? ? metalc8 metalc ? ? A ASP 56 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 133 A CA 202 1_555 ? ? ? ? ? ? ? 4.808 ? ? metalc9 metalc ? ? A ASP 56 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 133 A CA 202 1_555 ? ? ? ? ? ? ? 3.162 ? ? metalc10 metalc ? ? A GLN 58 OE1 ? ? ? 1_555 B CA . CA ? ? A GLN 135 A CA 201 1_555 ? ? ? ? ? ? ? 3.090 ? ? metalc11 metalc ? ? A GLN 58 O ? ? ? 1_555 C CA . CA ? ? A GLN 135 A CA 202 1_555 ? ? ? ? ? ? ? 2.594 ? ? metalc12 metalc ? ? A GLU 63 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 140 A CA 202 1_555 ? ? ? ? ? ? ? 3.083 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 16 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASN 20 ? A ASN 97 ? 1_555 49.9 ? 2 OD1 ? A ASP 16 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A TYR 22 ? A TYR 99 ? 1_555 60.8 ? 3 OD1 ? A ASN 20 ? A ASN 97 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A TYR 22 ? A TYR 99 ? 1_555 90.4 ? 4 OD1 ? A ASP 16 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 27 ? A GLU 104 ? 1_555 57.3 ? 5 OD1 ? A ASN 20 ? A ASN 97 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 27 ? A GLU 104 ? 1_555 97.5 ? 6 O ? A TYR 22 ? A TYR 99 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 27 ? A GLU 104 ? 1_555 84.6 ? 7 OD1 ? A ASP 16 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 27 ? A GLU 104 ? 1_555 54.3 ? 8 OD1 ? A ASN 20 ? A ASN 97 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 27 ? A GLU 104 ? 1_555 65.2 ? 9 O ? A TYR 22 ? A TYR 99 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 27 ? A GLU 104 ? 1_555 111.0 ? 10 OE1 ? A GLU 27 ? A GLU 104 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 27 ? A GLU 104 ? 1_555 42.6 ? 11 OD1 ? A ASP 16 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLN 58 ? A GLN 135 ? 1_555 137.9 ? 12 OD1 ? A ASN 20 ? A ASN 97 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLN 58 ? A GLN 135 ? 1_555 114.3 ? 13 O ? A TYR 22 ? A TYR 99 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLN 58 ? A GLN 135 ? 1_555 83.6 ? 14 OE1 ? A GLU 27 ? A GLU 104 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLN 58 ? A GLN 135 ? 1_555 146.0 ? 15 OE2 ? A GLU 27 ? A GLU 104 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLN 58 ? A GLN 135 ? 1_555 165.2 ? 16 OD1 ? A ASP 52 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD2 ? A ASP 52 ? A ASP 129 ? 1_555 42.5 ? 17 OD1 ? A ASP 52 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD2 ? A ASP 56 ? A ASP 133 ? 1_555 88.7 ? 18 OD2 ? A ASP 52 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD2 ? A ASP 56 ? A ASP 133 ? 1_555 94.8 ? 19 OD1 ? A ASP 52 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 56 ? A ASP 133 ? 1_555 69.0 ? 20 OD2 ? A ASP 52 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 56 ? A ASP 133 ? 1_555 76.2 ? 21 OD2 ? A ASP 56 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 56 ? A ASP 133 ? 1_555 20.6 ? 22 OD1 ? A ASP 52 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A GLN 58 ? A GLN 135 ? 1_555 101.8 ? 23 OD2 ? A ASP 52 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A GLN 58 ? A GLN 135 ? 1_555 72.6 ? 24 OD2 ? A ASP 56 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A GLN 58 ? A GLN 135 ? 1_555 52.6 ? 25 OD1 ? A ASP 56 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A GLN 58 ? A GLN 135 ? 1_555 55.0 ? 26 OD1 ? A ASP 52 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 63 ? A GLU 140 ? 1_555 149.3 ? 27 OD2 ? A ASP 52 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 63 ? A GLU 140 ? 1_555 119.3 ? 28 OD2 ? A ASP 56 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 63 ? A GLU 140 ? 1_555 120.7 ? 29 OD1 ? A ASP 56 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 63 ? A GLU 140 ? 1_555 138.5 ? 30 O ? A GLN 58 ? A GLN 135 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 63 ? A GLU 140 ? 1_555 91.0 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 201 ? 7 'BINDING SITE FOR RESIDUE CA A 201' AC2 Software A CA 202 ? 6 'BINDING SITE FOR RESIDUE CA A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ASP A 16 ? ASP A 93 . ? 1_555 ? 2 AC1 7 ASN A 20 ? ASN A 97 . ? 1_555 ? 3 AC1 7 TYR A 22 ? TYR A 99 . ? 1_555 ? 4 AC1 7 ILE A 23 ? ILE A 100 . ? 1_555 ? 5 AC1 7 SER A 24 ? SER A 101 . ? 1_555 ? 6 AC1 7 GLU A 27 ? GLU A 104 . ? 1_555 ? 7 AC1 7 GLN A 58 ? GLN A 135 . ? 1_555 ? 8 AC2 6 ASP A 52 ? ASP A 129 . ? 1_555 ? 9 AC2 6 ILE A 53 ? ILE A 130 . ? 1_555 ? 10 AC2 6 ASP A 54 ? ASP A 131 . ? 1_555 ? 11 AC2 6 ASP A 56 ? ASP A 133 . ? 1_555 ? 12 AC2 6 GLN A 58 ? GLN A 135 . ? 1_555 ? 13 AC2 6 GLU A 63 ? GLU A 140 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PHE 141 ? ? H A MET 144 ? ? 1.59 2 2 H2 A ASP 78 ? ? H A THR 79 ? ? 1.28 3 2 HE A ARG 90 ? ? HH A TYR 138 ? ? 1.34 4 2 OD1 A ASP 129 ? ? H A GLY 132 ? ? 1.55 5 2 O A ILE 125 ? ? H A ASP 129 ? ? 1.60 6 2 O A GLU 120 ? ? H A MET 124 ? ? 1.60 7 3 O A PHE 141 ? ? H A MET 144 ? ? 1.54 8 4 HD22 A ASN 137 ? ? H A GLU 140 ? ? 1.18 9 6 O A PHE 141 ? ? H A MET 144 ? ? 1.53 10 8 O A GLU 120 ? ? H A MET 124 ? ? 1.60 11 9 O A GLU 120 ? ? H A MET 124 ? ? 1.58 12 11 O A PHE 141 ? ? H A MET 144 ? ? 1.58 13 13 O A PHE 141 ? ? H A MET 144 ? ? 1.50 14 14 O A GLU 120 ? ? H A MET 124 ? ? 1.56 15 16 HD22 A ASN 137 ? ? H A GLU 140 ? ? 1.35 16 17 O A GLU 120 ? ? H A MET 124 ? ? 1.59 17 18 O A GLU 120 ? ? H A MET 124 ? ? 1.54 18 18 OD1 A ASP 129 ? ? H A GLY 132 ? ? 1.59 19 19 O A PHE 141 ? ? H A MET 144 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 81 ? ? -164.52 -20.91 2 1 ASP A 93 ? ? -48.71 95.82 3 1 ASP A 95 ? ? -74.92 24.36 4 1 ALA A 128 ? ? -96.95 35.81 5 1 ASN A 137 ? ? -71.81 -155.02 6 1 GLU A 140 ? ? -31.70 -31.23 7 1 GLN A 143 ? ? -44.03 -15.28 8 1 ALA A 147 ? ? -59.54 80.90 9 2 THR A 79 ? ? -169.74 -146.79 10 2 ASP A 80 ? ? -71.75 21.00 11 2 GLU A 82 ? ? -44.47 -17.29 12 2 ASP A 93 ? ? -56.03 85.57 13 2 ASN A 137 ? ? -65.05 -157.99 14 2 GLU A 140 ? ? -32.86 -29.76 15 2 MET A 145 ? ? 41.74 -91.51 16 3 SER A 81 ? ? 76.89 71.87 17 3 GLU A 82 ? ? -49.45 -15.42 18 3 ASP A 93 ? ? -46.68 93.88 19 3 ASP A 129 ? ? -39.33 117.37 20 3 ASN A 137 ? ? -72.60 -153.49 21 3 GLU A 140 ? ? -32.36 -31.16 22 3 GLN A 143 ? ? -43.37 -15.54 23 3 ALA A 147 ? ? -48.85 109.16 24 4 THR A 79 ? ? 41.89 72.67 25 4 ASP A 80 ? ? -31.09 -74.60 26 4 SER A 81 ? ? -172.09 -9.35 27 4 GLU A 82 ? ? -45.55 -17.53 28 4 ASP A 93 ? ? -48.72 91.11 29 4 ASP A 95 ? ? -69.61 11.54 30 4 ASN A 137 ? ? -68.81 -152.69 31 4 GLU A 140 ? ? -31.73 -30.40 32 4 GLN A 143 ? ? -42.42 -70.38 33 4 MET A 145 ? ? -32.31 107.56 34 5 THR A 79 ? ? 40.85 80.40 35 5 SER A 81 ? ? 52.17 84.93 36 5 GLU A 82 ? ? -48.70 -14.99 37 5 ASP A 93 ? ? -48.05 92.60 38 5 ASP A 95 ? ? -73.13 21.42 39 5 ASN A 137 ? ? -67.15 -155.21 40 5 GLU A 140 ? ? -31.89 -29.23 41 5 THR A 146 ? ? -90.17 -60.33 42 6 ASP A 80 ? ? -70.00 -71.30 43 6 SER A 81 ? ? 169.99 55.42 44 6 ASP A 93 ? ? -49.85 94.56 45 6 ALA A 128 ? ? -154.06 36.16 46 6 ASP A 131 ? ? 42.34 3.08 47 6 ASN A 137 ? ? -64.46 -152.73 48 6 GLU A 139 ? ? -52.54 -70.47 49 6 GLU A 140 ? ? -32.96 -28.10 50 6 GLN A 143 ? ? -43.37 -15.29 51 7 SER A 81 ? ? 35.63 -142.66 52 7 ASP A 93 ? ? -56.82 86.51 53 7 ASN A 137 ? ? -65.32 -159.88 54 7 GLU A 140 ? ? -31.88 -26.96 55 7 MET A 145 ? ? -43.76 -111.27 56 8 THR A 79 ? ? -141.72 -155.51 57 8 SER A 81 ? ? 28.76 -83.03 58 8 ASP A 93 ? ? -45.19 96.75 59 8 ASN A 137 ? ? -65.40 -153.74 60 8 GLU A 140 ? ? -32.83 -29.66 61 9 GLU A 82 ? ? -45.32 -15.35 62 9 ASP A 93 ? ? -51.26 88.30 63 9 ASN A 137 ? ? -65.77 -153.80 64 9 GLU A 140 ? ? -31.39 -28.48 65 9 THR A 146 ? ? -78.31 47.29 66 10 SER A 81 ? ? 70.16 -49.09 67 10 ASP A 93 ? ? -51.29 86.33 68 10 ASP A 95 ? ? -66.29 16.09 69 10 ASN A 137 ? ? -68.25 -152.77 70 10 GLU A 140 ? ? -32.17 -29.85 71 11 THR A 79 ? ? -99.76 -60.66 72 11 GLU A 87 ? ? -73.52 -70.18 73 11 ASP A 93 ? ? -50.00 108.80 74 11 ALA A 128 ? ? -93.70 33.42 75 11 ASN A 137 ? ? -74.54 -154.11 76 11 GLU A 140 ? ? -33.23 -32.59 77 11 GLN A 143 ? ? -43.55 -16.17 78 12 SER A 81 ? ? -93.77 51.72 79 12 GLU A 82 ? ? -44.75 -19.75 80 12 ASP A 93 ? ? -48.76 93.41 81 12 ASP A 129 ? ? -37.16 124.81 82 12 ASP A 131 ? ? 37.54 5.09 83 12 ASN A 137 ? ? -66.65 -153.42 84 12 GLU A 140 ? ? -33.12 -27.42 85 13 THR A 79 ? ? -149.65 26.74 86 13 ASP A 93 ? ? -52.16 90.11 87 13 ASP A 129 ? ? -39.29 121.92 88 13 ASP A 133 ? ? -96.86 32.46 89 13 ASN A 137 ? ? -71.70 -153.30 90 13 GLU A 140 ? ? -31.19 -31.46 91 13 GLN A 143 ? ? -41.94 -14.65 92 13 MET A 145 ? ? -45.87 -125.98 93 14 THR A 79 ? ? 39.80 76.99 94 14 GLU A 82 ? ? -39.42 -27.26 95 14 ASP A 93 ? ? -50.22 87.65 96 14 LYS A 115 ? ? -143.49 52.12 97 14 ASN A 137 ? ? -65.83 -152.20 98 14 GLU A 140 ? ? -32.51 -28.50 99 14 GLN A 143 ? ? -43.33 -70.25 100 15 SER A 81 ? ? -170.10 -25.98 101 15 ASP A 93 ? ? -55.48 82.83 102 15 ASP A 95 ? ? -64.68 4.69 103 15 ASN A 137 ? ? -65.01 -154.90 104 15 GLU A 140 ? ? -32.71 -27.33 105 16 SER A 81 ? ? 86.07 10.05 106 16 GLU A 82 ? ? -56.58 -2.51 107 16 ASP A 93 ? ? -52.32 89.09 108 16 LEU A 116 ? ? -77.86 -169.13 109 16 MET A 124 ? ? -50.41 -70.59 110 16 ASN A 137 ? ? -66.55 -154.10 111 16 GLU A 139 ? ? -57.31 -72.23 112 16 GLU A 140 ? ? -30.68 -26.10 113 17 SER A 81 ? ? 59.49 81.78 114 17 GLU A 82 ? ? -49.97 -15.91 115 17 ASP A 93 ? ? -51.93 86.81 116 17 ASP A 133 ? ? -90.54 35.51 117 17 ASN A 137 ? ? -67.81 -155.27 118 17 GLU A 140 ? ? -31.39 -30.22 119 18 SER A 81 ? ? 47.01 82.93 120 18 ASP A 93 ? ? -43.54 101.22 121 18 ASN A 137 ? ? -68.25 -154.69 122 18 GLU A 140 ? ? -33.03 -27.30 123 18 MET A 145 ? ? -36.72 114.38 124 19 THR A 79 ? ? 39.83 75.11 125 19 SER A 81 ? ? -123.39 -65.71 126 19 GLU A 82 ? ? -45.76 -15.38 127 19 ASP A 93 ? ? -52.15 88.53 128 19 ASP A 95 ? ? -68.82 26.38 129 19 LEU A 116 ? ? -78.07 -167.92 130 19 MET A 124 ? ? -52.00 -70.39 131 19 ASN A 137 ? ? -72.54 -151.81 132 19 GLU A 140 ? ? -29.85 -31.05 133 19 GLN A 143 ? ? -44.05 -13.80 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 19 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LQP _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LQP _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '20 mM TRIS, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component TRIS-1 _pdbx_nmr_exptl_sample.concentration 20 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aromatic' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D C(CO)NH' 1 5 1 '3D HNCO' 1 6 1 '3D HNCACB' 1 7 1 '3D H(CCO)NH' 1 8 1 '3D HCCH-TOCSY' 1 9 1 '3D 1H-13C NOESY aliphatic' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '3D HCACO' 1 12 1 '2D 1H-15N HSQC' 1 13 1 '3D HBHA(CO)NH' # _pdbx_nmr_refine.entry_id 2LQP _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 3 'Cornilescu, Delaglio and Bax' 'chemical shift calculation' TALOS ? 4 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 5 'Bruker Biospin' collection XwinNMR ? 6 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MET N N N N 214 MET CA C N S 215 MET C C N N 216 MET O O N N 217 MET CB C N N 218 MET CG C N N 219 MET SD S N N 220 MET CE C N N 221 MET OXT O N N 222 MET H H N N 223 MET H2 H N N 224 MET HA H N N 225 MET HB2 H N N 226 MET HB3 H N N 227 MET HG2 H N N 228 MET HG3 H N N 229 MET HE1 H N N 230 MET HE2 H N N 231 MET HE3 H N N 232 MET HXT H N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 SER N N N N 257 SER CA C N S 258 SER C C N N 259 SER O O N N 260 SER CB C N N 261 SER OG O N N 262 SER OXT O N N 263 SER H H N N 264 SER H2 H N N 265 SER HA H N N 266 SER HB2 H N N 267 SER HB3 H N N 268 SER HG H N N 269 SER HXT H N N 270 THR N N N N 271 THR CA C N S 272 THR C C N N 273 THR O O N N 274 THR CB C N R 275 THR OG1 O N N 276 THR CG2 C N N 277 THR OXT O N N 278 THR H H N N 279 THR H2 H N N 280 THR HA H N N 281 THR HB H N N 282 THR HG1 H N N 283 THR HG21 H N N 284 THR HG22 H N N 285 THR HG23 H N N 286 THR HXT H N N 287 TYR N N N N 288 TYR CA C N S 289 TYR C C N N 290 TYR O O N N 291 TYR CB C N N 292 TYR CG C Y N 293 TYR CD1 C Y N 294 TYR CD2 C Y N 295 TYR CE1 C Y N 296 TYR CE2 C Y N 297 TYR CZ C Y N 298 TYR OH O N N 299 TYR OXT O N N 300 TYR H H N N 301 TYR H2 H N N 302 TYR HA H N N 303 TYR HB2 H N N 304 TYR HB3 H N N 305 TYR HD1 H N N 306 TYR HD2 H N N 307 TYR HE1 H N N 308 TYR HE2 H N N 309 TYR HH H N N 310 TYR HXT H N N 311 VAL N N N N 312 VAL CA C N S 313 VAL C C N N 314 VAL O O N N 315 VAL CB C N N 316 VAL CG1 C N N 317 VAL CG2 C N N 318 VAL OXT O N N 319 VAL H H N N 320 VAL H2 H N N 321 VAL HA H N N 322 VAL HB H N N 323 VAL HG11 H N N 324 VAL HG12 H N N 325 VAL HG13 H N N 326 VAL HG21 H N N 327 VAL HG22 H N N 328 VAL HG23 H N N 329 VAL HXT H N N 330 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 THR N CA sing N N 258 THR N H sing N N 259 THR N H2 sing N N 260 THR CA C sing N N 261 THR CA CB sing N N 262 THR CA HA sing N N 263 THR C O doub N N 264 THR C OXT sing N N 265 THR CB OG1 sing N N 266 THR CB CG2 sing N N 267 THR CB HB sing N N 268 THR OG1 HG1 sing N N 269 THR CG2 HG21 sing N N 270 THR CG2 HG22 sing N N 271 THR CG2 HG23 sing N N 272 THR OXT HXT sing N N 273 TYR N CA sing N N 274 TYR N H sing N N 275 TYR N H2 sing N N 276 TYR CA C sing N N 277 TYR CA CB sing N N 278 TYR CA HA sing N N 279 TYR C O doub N N 280 TYR C OXT sing N N 281 TYR CB CG sing N N 282 TYR CB HB2 sing N N 283 TYR CB HB3 sing N N 284 TYR CG CD1 doub Y N 285 TYR CG CD2 sing Y N 286 TYR CD1 CE1 sing Y N 287 TYR CD1 HD1 sing N N 288 TYR CD2 CE2 doub Y N 289 TYR CD2 HD2 sing N N 290 TYR CE1 CZ doub Y N 291 TYR CE1 HE1 sing N N 292 TYR CE2 CZ sing Y N 293 TYR CE2 HE2 sing N N 294 TYR CZ OH sing N N 295 TYR OH HH sing N N 296 TYR OXT HXT sing N N 297 VAL N CA sing N N 298 VAL N H sing N N 299 VAL N H2 sing N N 300 VAL CA C sing N N 301 VAL CA CB sing N N 302 VAL CA HA sing N N 303 VAL C O doub N N 304 VAL C OXT sing N N 305 VAL CB CG1 sing N N 306 VAL CB CG2 sing N N 307 VAL CB HB sing N N 308 VAL CG1 HG11 sing N N 309 VAL CG1 HG12 sing N N 310 VAL CG1 HG13 sing N N 311 VAL CG2 HG21 sing N N 312 VAL CG2 HG22 sing N N 313 VAL CG2 HG23 sing N N 314 VAL OXT HXT sing N N 315 # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2LQP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_