data_2LRN # _entry.id 2LRN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LRN RCSB RCSB102747 BMRB 18387 WWPDB D_1000102747 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified NYSGRC-011666 TargetDB . unspecified 18387 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LRN _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-04-10 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Harris, R.' 1 'Bandaranayake, A.D.' 2 'Banu, R.' 3 'Bonanno, J.B.' 4 'Calarese, D.A.' 5 'Celikgil, A.' 6 'Chamala, S.' 7 'Chan, M.K.' 8 'Chaparro, R.' 9 'Evans, B.' 10 'Garforth, S.' 11 'Gizzi, A.' 12 'Hillerich, B.' 13 'Kar, A.' 14 'Lafleur, J.' 15 'Lim, S.' 16 'Love, J.' 17 'Matikainen, B.' 18 'Patel, H.' 19 'Seidel, R.D.' 20 'Smith, B.' 21 'Stead, M.' 22 'Girvin, M.E.' 23 'Almo, S.C.' 24 'New York Structural Genomics Research Consortium (NYSGRC)' 25 # _citation.id primary _citation.title 'Solution structure of a thiol:disulfide interchange protein from Bacteroides sp.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Harris, R.' 1 primary 'Bandaranayake, A.D.' 2 primary 'Banu, R.' 3 primary 'Bonanno, J.B.' 4 primary 'Calarese, D.A.' 5 primary 'Celikgil, A.' 6 primary 'Chamala, S.' 7 primary 'Chan, M.K.' 8 primary 'Chaparro, R.' 9 primary 'Evans, B.' 10 primary 'Garforth, S.' 11 primary 'Gizzi, A.' 12 primary 'Hillerich, B.' 13 primary 'Kar, A.' 14 primary 'Lafleur, J.' 15 primary 'Lim, S.' 16 primary 'Love, J.' 17 primary 'Matikainen, B.' 18 primary 'Patel, H.' 19 primary 'Seidel, R.D.' 20 primary 'Smith, B.' 21 primary 'Stead, M.' 22 primary 'Girvin, M.E.' 23 primary 'Almo, S.C.' 24 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Thiol:disulfide interchange protein' _entity.formula_weight 17364.656 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 252-392' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSLATGSVAPAITGIDLKGNSVSLNDFKGKYVLVDFWFAGCSWCRKETPYLLKTYNAFKDKGFTIYGVSTDRREEDWKKA IEEDKSYWNQVLLQKDDVKDVLESYCIVGFPHIILVDPEGKIVAKELRGDDLYNTVEKFVNGAKEGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLATGSVAPAITGIDLKGNSVSLNDFKGKYVLVDFWFAGCSWCRKETPYLLKTYNAFKDKGFTIYGVSTDRREEDWKKA IEEDKSYWNQVLLQKDDVKDVLESYCIVGFPHIILVDPEGKIVAKELRGDDLYNTVEKFVNGAKEGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGRC-011666 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LEU n 1 4 ALA n 1 5 THR n 1 6 GLY n 1 7 SER n 1 8 VAL n 1 9 ALA n 1 10 PRO n 1 11 ALA n 1 12 ILE n 1 13 THR n 1 14 GLY n 1 15 ILE n 1 16 ASP n 1 17 LEU n 1 18 LYS n 1 19 GLY n 1 20 ASN n 1 21 SER n 1 22 VAL n 1 23 SER n 1 24 LEU n 1 25 ASN n 1 26 ASP n 1 27 PHE n 1 28 LYS n 1 29 GLY n 1 30 LYS n 1 31 TYR n 1 32 VAL n 1 33 LEU n 1 34 VAL n 1 35 ASP n 1 36 PHE n 1 37 TRP n 1 38 PHE n 1 39 ALA n 1 40 GLY n 1 41 CYS n 1 42 SER n 1 43 TRP n 1 44 CYS n 1 45 ARG n 1 46 LYS n 1 47 GLU n 1 48 THR n 1 49 PRO n 1 50 TYR n 1 51 LEU n 1 52 LEU n 1 53 LYS n 1 54 THR n 1 55 TYR n 1 56 ASN n 1 57 ALA n 1 58 PHE n 1 59 LYS n 1 60 ASP n 1 61 LYS n 1 62 GLY n 1 63 PHE n 1 64 THR n 1 65 ILE n 1 66 TYR n 1 67 GLY n 1 68 VAL n 1 69 SER n 1 70 THR n 1 71 ASP n 1 72 ARG n 1 73 ARG n 1 74 GLU n 1 75 GLU n 1 76 ASP n 1 77 TRP n 1 78 LYS n 1 79 LYS n 1 80 ALA n 1 81 ILE n 1 82 GLU n 1 83 GLU n 1 84 ASP n 1 85 LYS n 1 86 SER n 1 87 TYR n 1 88 TRP n 1 89 ASN n 1 90 GLN n 1 91 VAL n 1 92 LEU n 1 93 LEU n 1 94 GLN n 1 95 LYS n 1 96 ASP n 1 97 ASP n 1 98 VAL n 1 99 LYS n 1 100 ASP n 1 101 VAL n 1 102 LEU n 1 103 GLU n 1 104 SER n 1 105 TYR n 1 106 CYS n 1 107 ILE n 1 108 VAL n 1 109 GLY n 1 110 PHE n 1 111 PRO n 1 112 HIS n 1 113 ILE n 1 114 ILE n 1 115 LEU n 1 116 VAL n 1 117 ASP n 1 118 PRO n 1 119 GLU n 1 120 GLY n 1 121 LYS n 1 122 ILE n 1 123 VAL n 1 124 ALA n 1 125 LYS n 1 126 GLU n 1 127 LEU n 1 128 ARG n 1 129 GLY n 1 130 ASP n 1 131 ASP n 1 132 LEU n 1 133 TYR n 1 134 ASN n 1 135 THR n 1 136 VAL n 1 137 GLU n 1 138 LYS n 1 139 PHE n 1 140 VAL n 1 141 ASN n 1 142 GLY n 1 143 ALA n 1 144 LYS n 1 145 GLU n 1 146 GLY n 1 147 HIS n 1 148 HIS n 1 149 HIS n 1 150 HIS n 1 151 HIS n 1 152 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BSFG_02257 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacteroides sp. 4_3_47FAA' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 457394 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET _entity_src_gen.pdbx_host_org_vector 'modified pET26' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C6Z5F1_9BACE _struct_ref.pdbx_db_accession C6Z5F1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATGSVAPAITGIDLKGNSVSLNDFKGKYVLVDFWFAGCSWCRKETPYLLKTYNAFKDKGFTIYGVSTDRREEDWKKAIEE DKSYWNQVLLQKDDVKDVLESYCIVGFPHIILVDPEGKIVAKELRGDDLYNTVEKFVNGAK ; _struct_ref.pdbx_align_begin 252 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LRN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 144 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C6Z5F1 _struct_ref_seq.db_align_beg 252 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 392 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 144 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LRN MET A 1 ? UNP C6Z5F1 ? ? 'EXPRESSION TAG' 1 1 1 2LRN SER A 2 ? UNP C6Z5F1 ? ? 'EXPRESSION TAG' 2 2 1 2LRN LEU A 3 ? UNP C6Z5F1 ? ? 'EXPRESSION TAG' 3 3 1 2LRN GLU A 145 ? UNP C6Z5F1 ? ? 'EXPRESSION TAG' 145 4 1 2LRN GLY A 146 ? UNP C6Z5F1 ? ? 'EXPRESSION TAG' 146 5 1 2LRN HIS A 147 ? UNP C6Z5F1 ? ? 'EXPRESSION TAG' 147 6 1 2LRN HIS A 148 ? UNP C6Z5F1 ? ? 'EXPRESSION TAG' 148 7 1 2LRN HIS A 149 ? UNP C6Z5F1 ? ? 'EXPRESSION TAG' 149 8 1 2LRN HIS A 150 ? UNP C6Z5F1 ? ? 'EXPRESSION TAG' 150 9 1 2LRN HIS A 151 ? UNP C6Z5F1 ? ? 'EXPRESSION TAG' 151 10 1 2LRN HIS A 152 ? UNP C6Z5F1 ? ? 'EXPRESSION TAG' 152 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '15N HSQC' 1 2 1 '15N NOESY-HSQC' 1 3 2 '13C CT-HSQC' 1 4 2 'aromatic 13C HSQC' 1 5 2 '13C NOESY-HSQC' 1 6 2 '13C aromatic NOESY-HSQC' 1 7 1 HNCO 1 8 1 HNCACO 1 9 1 HNCA 1 10 1 HNCOCA 1 11 1 HNCACB 1 12 1 CBCACONH # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 70 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1 mM [U-13C; U-15N] thiol:disulfide interchange protein, 20 mM sodium phosphate, 50 mM sodium chloride, 1 mM DTT, 1 mM EDTA, 90% H2O, 10% D2O ; 1 '90% H2O/10% D2O' ;1 mM [U-13C; U-15N] thiol:disulfide interchange protein, 20 mM sodium phosphate, 50 mM sodium chloride, 1 mM DTT, 1 mM EDTA, 100% D2O ; 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian Inova' 900 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LRN _pdbx_nmr_refine.method 'simulating annealing' _pdbx_nmr_refine.details 'Refinement in a box of water' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2LRN _pdbx_nmr_details.text '3D experiments acquired with NUS using the MDDNMR approach' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria '20 structures for lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LRN _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LRN _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger A. T. et.al.' refinement CNS 1.21 1 'Brunger A. T. et.al.' 'structure solution' CNS 1.21 2 CCPN 'peak picking' CCPN 2.1.5 3 CCPN 'chemical shift assignment' CCPN 2.1.5 4 ;Linge, O'Donoghue and Nilges ; 'data analysis' ARIA 2.3 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 5.4 6 'Orekhov, Jaravine, Kazimierczuk' processing MDDNMR 2.0 7 'Orekhov, Jaravine, Kazimierczuk' collection MDDNMR 2.0 8 'Lemak, Gutmanas, Chitayat, Karra, Fares, Sunnerhagen, Arrowsmith' collection MDDGUI 1.0 9 'Lemak, Gutmanas, Chitayat, Karra, Fares, Sunnerhagen, Arrowsmith' processing MDDGUI 1.0 10 Varian collection VNMRJ 2.2D 11 'Bruker Biospin' collection TOPSPIN 2.1 12 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LRN _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LRN _struct.title 'Solution structure of a thiol:disulfide interchange protein from Bacteroides sp.' _struct.pdbx_descriptor 'Thiol:disulfide interchange protein' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LRN _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'STRUCTURAL GENOMICS, THIOREDOXIN-LIKE, New York Structural Genomics Research Consortium, OXIDOREDUCTASE, PSI-Biology, NYSGRC' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 25 ? LYS A 28 ? ASN A 25 LYS A 28 5 ? 4 HELX_P HELX_P2 2 TRP A 43 ? LYS A 59 ? TRP A 43 LYS A 59 1 ? 17 HELX_P HELX_P3 3 ARG A 73 ? LYS A 85 ? ARG A 73 LYS A 85 1 ? 13 HELX_P HELX_P4 4 GLN A 94 ? TYR A 105 ? GLN A 94 TYR A 105 1 ? 12 HELX_P HELX_P5 5 ASP A 130 ? ASN A 141 ? ASP A 130 ASN A 141 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 1 -1.10 2 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 2 -0.16 3 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 3 -0.74 4 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 4 -0.50 5 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 5 -0.34 6 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 6 0.73 7 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 7 -1.23 8 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 8 -0.43 9 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 9 -0.09 10 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 10 -1.21 11 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 11 -0.27 12 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 12 -0.33 13 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 13 2.33 14 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 14 -1.34 15 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 15 0.07 16 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 16 -0.96 17 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 17 0.65 18 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 18 -0.43 19 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 19 -0.81 20 PHE 110 A . ? PHE 110 A PRO 111 A ? PRO 111 A 20 0.13 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 7 ? VAL A 8 ? SER A 7 VAL A 8 A 2 LYS A 121 ? LYS A 125 ? LYS A 121 LYS A 125 A 3 HIS A 112 ? VAL A 116 ? HIS A 112 VAL A 116 A 4 TYR A 31 ? TRP A 37 ? TYR A 31 TRP A 37 A 5 PHE A 63 ? SER A 69 ? PHE A 63 SER A 69 A 6 ASN A 89 ? LEU A 93 ? ASN A 89 LEU A 93 A 7 THR A 13 ? ILE A 15 ? THR A 13 ILE A 15 A 8 SER A 21 ? SER A 23 ? SER A 21 SER A 23 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 7 ? N SER A 7 O ILE A 122 ? O ILE A 122 A 2 3 O ALA A 124 ? O ALA A 124 N LEU A 115 ? N LEU A 115 A 3 4 O VAL A 116 ? O VAL A 116 N VAL A 32 ? N VAL A 32 A 4 5 N TYR A 31 ? N TYR A 31 O THR A 64 ? O THR A 64 A 5 6 N SER A 69 ? N SER A 69 O LEU A 93 ? O LEU A 93 A 6 7 O LEU A 92 ? O LEU A 92 N ILE A 15 ? N ILE A 15 A 7 8 N GLY A 14 ? N GLY A 14 O VAL A 22 ? O VAL A 22 # _atom_sites.entry_id 2LRN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 TRP 88 88 88 TRP TRP A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 CYS 106 106 106 CYS CYS A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 HIS 149 149 149 HIS HIS A . n A 1 150 HIS 150 150 150 HIS HIS A . n A 1 151 HIS 151 151 151 HIS HIS A . n A 1 152 HIS 152 152 152 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'New York Structural Genomics Research Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NYSGRC _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2012-04-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'thiol:disulfide interchange protein-1' 1 ? mM '[U-13C; U-15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 50 ? mM ? 1 DTT-4 1 ? mM ? 1 EDTA-5 1 ? mM ? 1 'thiol:disulfide interchange protein-6' 1 ? mM '[U-13C; U-15N]' 2 'sodium phosphate-7' 20 ? mM ? 2 'sodium chloride-8' 50 ? mM ? 2 DTT-9 1 ? mM ? 2 EDTA-10 1 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LRN _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 106 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 3013 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 631 _pdbx_nmr_constraints.NOE_long_range_total_count 933 _pdbx_nmr_constraints.NOE_medium_range_total_count 577 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 595 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 93 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 93 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HB A THR 70 ? ? HB2 A LEU 93 ? ? 1.23 2 1 OE2 A GLU 74 ? ? HZ2 A LYS 78 ? ? 1.53 3 1 HZ3 A LYS 28 ? ? OE1 A GLU 119 ? ? 1.55 4 1 HZ3 A LYS 59 ? ? OD2 A ASP 60 ? ? 1.57 5 1 OE2 A GLU 119 ? ? HZ2 A LYS 121 ? ? 1.58 6 1 HD1 A HIS 149 ? ? OXT A HIS 152 ? ? 1.59 7 1 HH11 A ARG 45 ? ? OD2 A ASP 84 ? ? 1.60 8 2 H1 A MET 1 ? ? OE2 A GLU 103 ? ? 1.55 9 2 OE1 A GLU 119 ? ? HZ1 A LYS 121 ? ? 1.56 10 2 OD2 A ASP 16 ? ? HZ1 A LYS 18 ? ? 1.60 11 3 HG2 A GLU 74 ? ? HE2 A LYS 78 ? ? 1.10 12 3 HD2 A TYR 105 ? ? HE2 A HIS 112 ? ? 1.31 13 3 HZ3 A LYS 138 ? ? OE2 A GLU 145 ? ? 1.53 14 4 HD2 A LYS 125 ? ? HG2 A GLU 126 ? ? 1.25 15 4 OE2 A GLU 74 ? ? HZ1 A LYS 78 ? ? 1.55 16 4 OE1 A GLU 47 ? ? HH12 A ARG 128 ? ? 1.56 17 4 OE2 A GLU 82 ? ? HZ2 A LYS 85 ? ? 1.57 18 4 HZ3 A LYS 95 ? ? OD2 A ASP 96 ? ? 1.59 19 4 HZ2 A LYS 59 ? ? OD2 A ASP 60 ? ? 1.59 20 4 OE2 A GLU 119 ? ? HZ1 A LYS 121 ? ? 1.59 21 4 HZ1 A LYS 53 ? ? OD1 A ASP 130 ? ? 1.60 22 5 OD2 A ASP 16 ? ? HZ2 A LYS 18 ? ? 1.57 23 6 OD1 A ASP 60 ? ? HZ1 A LYS 61 ? ? 1.56 24 6 HZ2 A LYS 28 ? ? OE2 A GLU 119 ? ? 1.57 25 6 OD1 A ASP 96 ? ? HZ3 A LYS 99 ? ? 1.57 26 6 HH22 A ARG 45 ? ? OE1 A GLU 83 ? ? 1.59 27 7 HG2 A GLU 74 ? ? HE2 A LYS 78 ? ? 1.19 28 7 HZ1 A LYS 79 ? ? OE2 A GLU 82 ? ? 1.54 29 7 OD2 A ASP 16 ? ? HZ2 A LYS 18 ? ? 1.56 30 7 O A TYR 105 ? ? HG A CYS 106 ? ? 1.57 31 7 H A ALA 39 ? ? OD1 A ASP 71 ? ? 1.60 32 8 OE2 A GLU 74 ? ? HZ2 A LYS 78 ? ? 1.53 33 8 OE2 A GLU 119 ? ? HZ2 A LYS 121 ? ? 1.57 34 8 OD2 A ASP 16 ? ? HZ3 A LYS 18 ? ? 1.58 35 8 HZ3 A LYS 79 ? ? OE1 A GLU 83 ? ? 1.58 36 8 HG A SER 23 ? ? OD1 A ASP 26 ? ? 1.59 37 9 HG21 A THR 5 ? ? HA A VAL 123 ? ? 1.33 38 9 OE2 A GLU 74 ? ? HZ2 A LYS 78 ? ? 1.52 39 9 OE2 A GLU 119 ? ? HZ1 A LYS 121 ? ? 1.55 40 9 OE2 A GLU 82 ? ? HZ3 A LYS 85 ? ? 1.57 41 10 OE2 A GLU 74 ? ? HZ2 A LYS 78 ? ? 1.54 42 10 OD2 A ASP 60 ? ? HZ2 A LYS 61 ? ? 1.56 43 10 HZ3 A LYS 99 ? ? OD1 A ASP 100 ? ? 1.57 44 10 OE2 A GLU 119 ? ? HZ1 A LYS 121 ? ? 1.58 45 11 HZ2 A LYS 53 ? ? HE1 A TYR 133 ? ? 1.19 46 11 HB A VAL 68 ? ? HD22 A LEU 93 ? ? 1.29 47 11 OE2 A GLU 74 ? ? HZ2 A LYS 78 ? ? 1.54 48 11 OD2 A ASP 16 ? ? HZ3 A LYS 18 ? ? 1.56 49 11 HZ2 A LYS 95 ? ? OD2 A ASP 96 ? ? 1.57 50 11 HZ2 A LYS 125 ? ? OE1 A GLU 126 ? ? 1.58 51 11 HZ2 A LYS 59 ? ? OD2 A ASP 60 ? ? 1.60 52 11 O A ASP 131 ? ? H A THR 135 ? ? 1.60 53 12 OE2 A GLU 74 ? ? HZ1 A LYS 78 ? ? 1.53 54 12 HZ2 A LYS 53 ? ? OD1 A ASP 130 ? ? 1.57 55 12 HG A SER 69 ? ? OD2 A ASP 71 ? ? 1.59 56 13 HA A LYS 138 ? ? HB3 A ALA 143 ? ? 1.30 57 13 OD2 A ASP 16 ? ? HZ2 A LYS 18 ? ? 1.55 58 13 OE2 A GLU 74 ? ? HZ2 A LYS 78 ? ? 1.57 59 13 OD1 A ASP 76 ? ? HZ3 A LYS 79 ? ? 1.58 60 13 HZ1 A LYS 125 ? ? OE1 A GLU 126 ? ? 1.58 61 13 HZ2 A LYS 59 ? ? OD2 A ASP 60 ? ? 1.59 62 14 HA A GLU 137 ? ? HD21 A ASN 141 ? ? 1.18 63 14 HB3 A LYS 61 ? ? HE1 A HIS 149 ? ? 1.29 64 14 HA A THR 70 ? ? HZ2 A LYS 95 ? ? 1.30 65 14 HZ1 A LYS 53 ? ? OD1 A ASP 130 ? ? 1.53 66 14 HZ1 A LYS 59 ? ? OD2 A ASP 60 ? ? 1.54 67 14 OE2 A GLU 74 ? ? HZ3 A LYS 78 ? ? 1.54 68 14 HZ1 A LYS 61 ? ? OE2 A GLU 137 ? ? 1.56 69 14 OE2 A GLU 82 ? ? HZ3 A LYS 85 ? ? 1.56 70 14 OD2 A ASP 16 ? ? HZ2 A LYS 18 ? ? 1.56 71 14 HE2 A HIS 112 ? ? OE2 A GLU 126 ? ? 1.58 72 15 HE3 A TRP 37 ? ? HG A CYS 44 ? ? 1.31 73 15 HA3 A GLY 40 ? ? HH12 A ARG 72 ? ? 1.34 74 15 OE2 A GLU 74 ? ? HZ1 A LYS 78 ? ? 1.52 75 15 HZ2 A LYS 28 ? ? OE2 A GLU 119 ? ? 1.53 76 15 OE1 A GLU 119 ? ? HZ2 A LYS 121 ? ? 1.58 77 15 HZ3 A LYS 53 ? ? OD1 A ASP 130 ? ? 1.60 78 16 HG11 A VAL 68 ? ? HD21 A LEU 93 ? ? 1.32 79 16 HG22 A THR 5 ? ? HA A VAL 123 ? ? 1.32 80 16 OE2 A GLU 74 ? ? HZ2 A LYS 78 ? ? 1.54 81 16 HZ2 A LYS 99 ? ? OD2 A ASP 100 ? ? 1.59 82 16 OD2 A ASP 16 ? ? HZ1 A LYS 18 ? ? 1.59 83 17 HZ2 A LYS 53 ? ? OD1 A ASP 130 ? ? 1.57 84 18 HB3 A GLU 119 ? ? HZ2 A LYS 121 ? ? 1.08 85 18 OE2 A GLU 82 ? ? HZ1 A LYS 85 ? ? 1.53 86 18 OD2 A ASP 16 ? ? HZ3 A LYS 18 ? ? 1.55 87 18 HZ3 A LYS 28 ? ? OE2 A GLU 119 ? ? 1.55 88 18 HZ3 A LYS 59 ? ? OD2 A ASP 60 ? ? 1.57 89 18 O A ASP 131 ? ? H A THR 135 ? ? 1.57 90 18 HE A ARG 128 ? ? OD2 A ASP 130 ? ? 1.58 91 19 HZ1 A LYS 99 ? ? OD1 A ASP 100 ? ? 1.57 92 19 OD1 A ASP 76 ? ? HZ2 A LYS 79 ? ? 1.57 93 19 O A ARG 128 ? ? H A LEU 132 ? ? 1.59 94 19 OE2 A GLU 82 ? ? HZ3 A LYS 85 ? ? 1.59 95 20 HZ2 A LYS 79 ? ? OE2 A GLU 83 ? ? 1.56 96 20 OE2 A GLU 82 ? ? HZ3 A LYS 85 ? ? 1.57 97 20 OE1 A GLU 119 ? ? HZ2 A LYS 121 ? ? 1.58 98 20 HZ1 A LYS 46 ? ? OD1 A ASP 84 ? ? 1.59 99 20 OE1 A GLU 145 ? ? HD1 A HIS 147 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 70 ? ? -145.87 54.79 2 1 ASP A 71 ? ? -68.63 -168.51 3 1 HIS A 147 ? ? 37.13 79.29 4 1 HIS A 150 ? ? 166.88 -36.49 5 2 ASN A 89 ? ? -68.49 99.81 6 2 GLU A 145 ? ? 54.41 1.25 7 2 HIS A 149 ? ? 75.39 -31.98 8 2 HIS A 150 ? ? 72.33 151.13 9 3 LEU A 3 ? ? 69.07 146.51 10 3 THR A 70 ? ? -106.40 42.22 11 3 HIS A 112 ? ? -166.89 106.52 12 3 GLU A 145 ? ? -80.19 31.65 13 3 HIS A 150 ? ? -68.51 -81.88 14 4 SER A 2 ? ? 58.94 -169.66 15 4 LYS A 28 ? ? -69.01 -174.11 16 4 LYS A 85 ? ? 71.12 30.66 17 4 TRP A 88 ? ? -151.70 -140.81 18 4 GLU A 126 ? ? 45.79 75.48 19 4 LYS A 144 ? ? 73.88 30.85 20 4 HIS A 151 ? ? 72.09 -72.26 21 5 LEU A 3 ? ? 58.75 -136.19 22 5 THR A 70 ? ? -116.20 59.85 23 5 ASP A 71 ? ? -69.69 -178.57 24 5 ASN A 89 ? ? -69.48 98.91 25 5 LYS A 144 ? ? 63.82 77.81 26 5 HIS A 147 ? ? 60.03 -165.56 27 6 SER A 2 ? ? 57.93 -163.81 28 6 ALA A 4 ? ? -96.02 -91.12 29 6 ARG A 72 ? ? -53.75 -71.67 30 6 LYS A 85 ? ? 70.88 32.39 31 6 TYR A 87 ? ? -118.13 74.58 32 6 TRP A 88 ? ? -133.94 -154.07 33 7 ALA A 4 ? ? -128.02 -79.61 34 7 TRP A 88 ? ? -141.04 -149.85 35 7 LYS A 144 ? ? -95.30 -77.76 36 7 HIS A 151 ? ? -119.89 -78.35 37 8 ALA A 4 ? ? -105.73 -168.81 38 8 ASP A 60 ? ? 73.70 -49.69 39 8 LYS A 61 ? ? -60.64 -88.33 40 8 TRP A 88 ? ? -150.97 -159.66 41 8 GLU A 126 ? ? 58.72 74.44 42 8 HIS A 150 ? ? -151.84 48.95 43 8 HIS A 151 ? ? -173.62 -55.37 44 9 HIS A 147 ? ? -59.64 109.33 45 10 SER A 2 ? ? -133.26 -75.66 46 10 ALA A 4 ? ? -135.25 -90.99 47 10 PHE A 38 ? ? -170.07 149.25 48 10 LYS A 61 ? ? -110.85 -161.96 49 10 ASP A 71 ? ? -60.62 -176.50 50 10 HIS A 150 ? ? -169.90 99.97 51 11 LEU A 3 ? ? 57.62 17.04 52 11 ALA A 4 ? ? 56.70 -135.12 53 11 ALA A 39 ? ? -66.96 86.99 54 11 LYS A 61 ? ? -55.04 -71.43 55 11 ASN A 141 ? ? -93.89 -62.09 56 11 HIS A 150 ? ? -155.10 6.65 57 11 HIS A 151 ? ? 61.78 79.60 58 12 ALA A 4 ? ? -135.18 -92.58 59 12 GLU A 145 ? ? -95.48 -87.19 60 12 HIS A 147 ? ? 77.44 -52.47 61 12 HIS A 148 ? ? 45.46 -107.35 62 12 HIS A 149 ? ? 53.90 92.87 63 13 SER A 2 ? ? 172.76 140.33 64 13 ALA A 4 ? ? -102.06 -90.12 65 13 ASP A 71 ? ? -66.67 -176.89 66 13 ASN A 89 ? ? -64.96 97.58 67 13 CYS A 106 ? ? 63.90 60.74 68 13 LYS A 144 ? ? -142.97 -42.77 69 13 HIS A 148 ? ? 69.71 -58.11 70 13 HIS A 151 ? ? 165.36 -38.49 71 14 SER A 2 ? ? 68.36 -66.74 72 14 HIS A 150 ? ? 72.43 143.92 73 15 LEU A 3 ? ? -64.83 -87.36 74 15 ALA A 4 ? ? 178.79 155.16 75 15 SER A 86 ? ? -67.01 81.06 76 15 LYS A 144 ? ? 62.92 -165.79 77 16 SER A 2 ? ? 50.12 -95.16 78 16 ALA A 4 ? ? -102.76 -166.88 79 16 THR A 70 ? ? -113.50 52.13 80 16 HIS A 147 ? ? 56.26 81.12 81 16 HIS A 148 ? ? -62.69 93.59 82 16 HIS A 150 ? ? -145.81 18.62 83 16 HIS A 151 ? ? -69.05 92.22 84 17 LEU A 3 ? ? -96.80 34.71 85 17 ALA A 4 ? ? 52.90 -140.13 86 17 THR A 70 ? ? -143.96 40.12 87 17 LYS A 144 ? ? -141.89 33.46 88 17 HIS A 151 ? ? 167.47 -19.91 89 18 THR A 70 ? ? -147.75 44.16 90 18 ASN A 89 ? ? -69.52 96.60 91 18 LYS A 144 ? ? -147.53 -52.16 92 18 GLU A 145 ? ? 71.11 -31.12 93 18 HIS A 151 ? ? -132.89 -42.88 94 19 SER A 2 ? ? 73.47 -93.45 95 19 ALA A 4 ? ? -144.82 -80.23 96 19 ASP A 60 ? ? 73.94 -36.90 97 19 ASP A 71 ? ? -65.29 -176.12 98 19 ASN A 89 ? ? -65.52 96.78 99 19 HIS A 151 ? ? 72.67 151.72 100 20 ALA A 143 ? ? 81.29 22.15 101 20 HIS A 149 ? ? 67.16 170.56 #