data_2LRR # _entry.id 2LRR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LRR pdb_00002lrr 10.2210/pdb2lrr/pdb RCSB RCSB102751 ? ? BMRB 18391 ? ? WWPDB D_1000102751 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 1msz PDB 'Structure of ligand free form' unspecified 18391 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LRR _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-04-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jaudzems, K.' 1 'Zhulenkovs, D.' 2 'Otting, G.' 3 'Liepinsh, E.' 4 # _citation.id primary _citation.title ;Structural Basis for 5'-End-Specific Recognition of Single-Stranded DNA by the R3H Domain from Human Smubp-2 ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 12 _citation.page_first 760 _citation.page_last 767 _citation.year 2012 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22999958 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2012.09.010 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jaudzems, K.' 1 ? primary 'Jia, X.' 2 ? primary 'Yagi, H.' 3 ? primary 'Zhulenkovs, D.' 4 ? primary 'Graham, B.' 5 ? primary 'Otting, G.' 6 ? primary 'Liepinsh, E.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA-binding protein SMUBP-2' 9706.846 1 '3.6.4.12, 3.6.4.13' ? 'R3H domain residues 711-786' ? 2 non-polymer syn "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" 347.221 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ATP-dependent helicase IGHMBP2, Glial factor 1, GF-1, Immunoglobulin mu-binding protein 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSLNGGSPEGVESQDGVDHFRAMIVEFMASKKMQLEFPPSLNSHDRLRVHQIAEEHGLRHDSSGEGKRRFITVSKRAGS HHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSLNGGSPEGVESQDGVDHFRAMIVEFMASKKMQLEFPPSLNSHDRLRVHQIAEEHGLRHDSSGEGKRRFITVSKRAGS HHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 LEU n 1 5 ASN n 1 6 GLY n 1 7 GLY n 1 8 SER n 1 9 PRO n 1 10 GLU n 1 11 GLY n 1 12 VAL n 1 13 GLU n 1 14 SER n 1 15 GLN n 1 16 ASP n 1 17 GLY n 1 18 VAL n 1 19 ASP n 1 20 HIS n 1 21 PHE n 1 22 ARG n 1 23 ALA n 1 24 MET n 1 25 ILE n 1 26 VAL n 1 27 GLU n 1 28 PHE n 1 29 MET n 1 30 ALA n 1 31 SER n 1 32 LYS n 1 33 LYS n 1 34 MET n 1 35 GLN n 1 36 LEU n 1 37 GLU n 1 38 PHE n 1 39 PRO n 1 40 PRO n 1 41 SER n 1 42 LEU n 1 43 ASN n 1 44 SER n 1 45 HIS n 1 46 ASP n 1 47 ARG n 1 48 LEU n 1 49 ARG n 1 50 VAL n 1 51 HIS n 1 52 GLN n 1 53 ILE n 1 54 ALA n 1 55 GLU n 1 56 GLU n 1 57 HIS n 1 58 GLY n 1 59 LEU n 1 60 ARG n 1 61 HIS n 1 62 ASP n 1 63 SER n 1 64 SER n 1 65 GLY n 1 66 GLU n 1 67 GLY n 1 68 LYS n 1 69 ARG n 1 70 ARG n 1 71 PHE n 1 72 ILE n 1 73 THR n 1 74 VAL n 1 75 SER n 1 76 LYS n 1 77 ARG n 1 78 ALA n 1 79 GLY n 1 80 SER n 1 81 HIS n 1 82 HIS n 1 83 HIS n 1 84 HIS n 1 85 HIS n 1 86 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'IGHMBP2, SMBP2, smubp-2, SMUBP2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain M15 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pQE60 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SMBP2_HUMAN _struct_ref.pdbx_db_accession P38935 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SLNGGSPEGVESQDGVDHFRAMIVEFMASKKMQLEFPPSLNSHDRLRVHQIAEEHGLRHDSSGEGKRRFITVSKRA _struct_ref.pdbx_align_begin 711 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LRR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 78 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P38935 _struct_ref_seq.db_align_beg 711 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 786 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 711 _struct_ref_seq.pdbx_auth_seq_align_end 786 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LRR MET A 1 ? UNP P38935 ? ? 'expression tag' 709 1 1 2LRR GLY A 2 ? UNP P38935 ? ? 'expression tag' 710 2 1 2LRR GLY A 79 ? UNP P38935 ? ? 'expression tag' 787 3 1 2LRR SER A 80 ? UNP P38935 ? ? 'expression tag' 788 4 1 2LRR HIS A 81 ? UNP P38935 ? ? 'expression tag' 789 5 1 2LRR HIS A 82 ? UNP P38935 ? ? 'expression tag' 790 6 1 2LRR HIS A 83 ? UNP P38935 ? ? 'expression tag' 791 7 1 2LRR HIS A 84 ? UNP P38935 ? ? 'expression tag' 792 8 1 2LRR HIS A 85 ? UNP P38935 ? ? 'expression tag' 793 9 1 2LRR HIS A 86 ? UNP P38935 ? ? 'expression tag' 794 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 DGP non-polymer n "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '3D 1H-15N NOESY' 1 5 1 '3D HNHA' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.9 mM [U-99% 15N] Smubp2_R3H, 5.5 mM 2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE, 5 % [U-100% 2H] D2O, 10 mM sodium phosphate, 100 mM sodium chloride, 0.03 % sodium azide, 95% H2O/5% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LRR _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LRR _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.34 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LRR _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VnmrJ 2.1b 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Bartels et al.' 'chemical shift assignment' XEASY ? 3 'Bartels et al.' 'peak picking' XEASY ? 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 5 'Guntert, Mumenthaler and Wuthrich' 'data analysis' CYANA 2.1 6 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 7 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LRR _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LRR _struct.title ;Solution structure of the R3H domain from human Smubp-2 in complex with 2'-deoxyguanosine-5'-monophosphate ; _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LRR _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'DNA Binding Protein, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 19 ? SER A 31 ? ASP A 727 SER A 739 1 ? 13 HELX_P HELX_P2 2 ASN A 43 ? GLY A 58 ? ASN A 751 GLY A 766 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 35 ? GLU A 37 ? GLN A 743 GLU A 745 A 2 PHE A 71 ? SER A 75 ? PHE A 779 SER A 783 A 3 ARG A 60 ? SER A 64 ? ARG A 768 SER A 772 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 36 ? N LEU A 744 O VAL A 74 ? O VAL A 782 A 2 3 O THR A 73 ? O THR A 781 N ASP A 62 ? N ASP A 770 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id DGP _struct_site.pdbx_auth_seq_id 801 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'BINDING SITE FOR RESIDUE DGP A 801' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 SER A 44 ? SER A 752 . ? 1_555 ? 2 AC1 8 ARG A 47 ? ARG A 755 . ? 1_555 ? 3 AC1 8 LEU A 48 ? LEU A 756 . ? 1_555 ? 4 AC1 8 HIS A 51 ? HIS A 759 . ? 1_555 ? 5 AC1 8 GLU A 55 ? GLU A 763 . ? 1_555 ? 6 AC1 8 HIS A 61 ? HIS A 769 . ? 1_555 ? 7 AC1 8 SER A 63 ? SER A 771 . ? 1_555 ? 8 AC1 8 ARG A 70 ? ARG A 778 . ? 1_555 ? # _atom_sites.entry_id 2LRR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 709 ? ? ? A . n A 1 2 GLY 2 710 ? ? ? A . n A 1 3 SER 3 711 ? ? ? A . n A 1 4 LEU 4 712 ? ? ? A . n A 1 5 ASN 5 713 ? ? ? A . n A 1 6 GLY 6 714 ? ? ? A . n A 1 7 GLY 7 715 ? ? ? A . n A 1 8 SER 8 716 ? ? ? A . n A 1 9 PRO 9 717 717 PRO PRO A . n A 1 10 GLU 10 718 718 GLU GLU A . n A 1 11 GLY 11 719 719 GLY GLY A . n A 1 12 VAL 12 720 720 VAL VAL A . n A 1 13 GLU 13 721 721 GLU GLU A . n A 1 14 SER 14 722 722 SER SER A . n A 1 15 GLN 15 723 723 GLN GLN A . n A 1 16 ASP 16 724 724 ASP ASP A . n A 1 17 GLY 17 725 725 GLY GLY A . n A 1 18 VAL 18 726 726 VAL VAL A . n A 1 19 ASP 19 727 727 ASP ASP A . n A 1 20 HIS 20 728 728 HIS HIS A . n A 1 21 PHE 21 729 729 PHE PHE A . n A 1 22 ARG 22 730 730 ARG ARG A . n A 1 23 ALA 23 731 731 ALA ALA A . n A 1 24 MET 24 732 732 MET MET A . n A 1 25 ILE 25 733 733 ILE ILE A . n A 1 26 VAL 26 734 734 VAL VAL A . n A 1 27 GLU 27 735 735 GLU GLU A . n A 1 28 PHE 28 736 736 PHE PHE A . n A 1 29 MET 29 737 737 MET MET A . n A 1 30 ALA 30 738 738 ALA ALA A . n A 1 31 SER 31 739 739 SER SER A . n A 1 32 LYS 32 740 740 LYS LYS A . n A 1 33 LYS 33 741 741 LYS LYS A . n A 1 34 MET 34 742 742 MET MET A . n A 1 35 GLN 35 743 743 GLN GLN A . n A 1 36 LEU 36 744 744 LEU LEU A . n A 1 37 GLU 37 745 745 GLU GLU A . n A 1 38 PHE 38 746 746 PHE PHE A . n A 1 39 PRO 39 747 747 PRO PRO A . n A 1 40 PRO 40 748 748 PRO PRO A . n A 1 41 SER 41 749 749 SER SER A . n A 1 42 LEU 42 750 750 LEU LEU A . n A 1 43 ASN 43 751 751 ASN ASN A . n A 1 44 SER 44 752 752 SER SER A . n A 1 45 HIS 45 753 753 HIS HIS A . n A 1 46 ASP 46 754 754 ASP ASP A . n A 1 47 ARG 47 755 755 ARG ARG A . n A 1 48 LEU 48 756 756 LEU LEU A . n A 1 49 ARG 49 757 757 ARG ARG A . n A 1 50 VAL 50 758 758 VAL VAL A . n A 1 51 HIS 51 759 759 HIS HIS A . n A 1 52 GLN 52 760 760 GLN GLN A . n A 1 53 ILE 53 761 761 ILE ILE A . n A 1 54 ALA 54 762 762 ALA ALA A . n A 1 55 GLU 55 763 763 GLU GLU A . n A 1 56 GLU 56 764 764 GLU GLU A . n A 1 57 HIS 57 765 765 HIS HIS A . n A 1 58 GLY 58 766 766 GLY GLY A . n A 1 59 LEU 59 767 767 LEU LEU A . n A 1 60 ARG 60 768 768 ARG ARG A . n A 1 61 HIS 61 769 769 HIS HIS A . n A 1 62 ASP 62 770 770 ASP ASP A . n A 1 63 SER 63 771 771 SER SER A . n A 1 64 SER 64 772 772 SER SER A . n A 1 65 GLY 65 773 773 GLY GLY A . n A 1 66 GLU 66 774 774 GLU GLU A . n A 1 67 GLY 67 775 775 GLY GLY A . n A 1 68 LYS 68 776 776 LYS LYS A . n A 1 69 ARG 69 777 777 ARG ARG A . n A 1 70 ARG 70 778 778 ARG ARG A . n A 1 71 PHE 71 779 779 PHE PHE A . n A 1 72 ILE 72 780 780 ILE ILE A . n A 1 73 THR 73 781 781 THR THR A . n A 1 74 VAL 74 782 782 VAL VAL A . n A 1 75 SER 75 783 783 SER SER A . n A 1 76 LYS 76 784 784 LYS LYS A . n A 1 77 ARG 77 785 785 ARG ARG A . n A 1 78 ALA 78 786 786 ALA ALA A . n A 1 79 GLY 79 787 ? ? ? A . n A 1 80 SER 80 788 ? ? ? A . n A 1 81 HIS 81 789 ? ? ? A . n A 1 82 HIS 82 790 ? ? ? A . n A 1 83 HIS 83 791 ? ? ? A . n A 1 84 HIS 84 792 ? ? ? A . n A 1 85 HIS 85 793 ? ? ? A . n A 1 86 HIS 86 794 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id DGP _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 801 _pdbx_nonpoly_scheme.auth_seq_num 787 _pdbx_nonpoly_scheme.pdb_mon_id DGP _pdbx_nonpoly_scheme.auth_mon_id DGP _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-10-24 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp 2 2 'Structure model' database_2 3 2 'Structure model' pdbx_database_status 4 2 'Structure model' pdbx_nmr_software 5 2 'Structure model' struct_ref_seq_dif 6 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_chem_comp.type' 2 2 'Structure model' '_database_2.pdbx_DOI' 3 2 'Structure model' '_database_2.pdbx_database_accession' 4 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 5 2 'Structure model' '_pdbx_nmr_software.name' 6 2 'Structure model' '_struct_ref_seq_dif.details' 7 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 8 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 9 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.0089 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.0011 _pdbx_nmr_ensemble_rms.entry_id 2LRR _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Smubp2_R3H-1 0.9 ? mM '[U-99% 15N]' 1 "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE-2" 5.5 ? mM ? 1 D2O-3 5 ? % '[U-100% 2H]' 1 'sodium phosphate-4' 10 ? mM ? 1 'sodium chloride-5' 100 ? mM ? 1 'sodium azide-6' 0.03 ? % ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LRR _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1359 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 347 _pdbx_nmr_constraints.NOE_long_range_total_count 431 _pdbx_nmr_constraints.NOE_medium_range_total_count 273 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 308 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 774 ? ? HZ3 A LYS 776 ? ? 1.56 2 1 OE1 A GLU 745 ? ? HG1 A THR 781 ? ? 1.59 3 2 OD1 A ASP 727 ? ? HH12 A ARG 757 ? ? 1.58 4 6 OD1 A ASP 727 ? ? HH21 A ARG 757 ? ? 1.55 5 8 HH11 A ARG 768 ? ? O A ALA 786 ? ? 1.59 6 14 HE A ARG 768 ? ? OD1 A ASP 770 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 774 ? ? -134.22 -100.58 2 3 ASP A 724 ? ? -93.99 43.93 3 3 ARG A 785 ? ? -118.91 -76.98 4 4 GLU A 718 ? ? -105.39 -75.78 5 4 GLN A 723 ? ? -73.77 -72.17 6 4 ASP A 724 ? ? -82.53 -86.89 7 5 GLU A 718 ? ? 62.83 95.63 8 7 SER A 722 ? ? -69.33 97.49 9 7 GLN A 723 ? ? -129.99 -52.38 10 8 ASP A 724 ? ? -74.79 -70.29 11 8 VAL A 726 ? ? -163.89 119.97 12 8 GLU A 774 ? ? -87.73 -77.48 13 9 GLU A 718 ? ? -105.20 -77.79 14 11 VAL A 720 ? ? -107.06 78.76 15 12 GLU A 718 ? ? 60.65 99.16 16 12 ASP A 724 ? ? -97.13 -156.92 17 13 LYS A 784 ? ? -68.20 -85.35 18 15 GLU A 774 ? ? -101.05 -84.39 19 17 GLU A 774 ? ? -94.76 -88.79 20 18 ARG A 785 ? ? -115.40 -81.42 21 20 ASP A 724 ? ? -104.09 -156.26 22 20 VAL A 726 ? ? -170.29 137.90 23 20 GLU A 774 ? ? -84.88 -92.64 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 709 ? A MET 1 2 1 Y 1 A GLY 710 ? A GLY 2 3 1 Y 1 A SER 711 ? A SER 3 4 1 Y 1 A LEU 712 ? A LEU 4 5 1 Y 1 A ASN 713 ? A ASN 5 6 1 Y 1 A GLY 714 ? A GLY 6 7 1 Y 1 A GLY 715 ? A GLY 7 8 1 Y 1 A SER 716 ? A SER 8 9 1 Y 1 A GLY 787 ? A GLY 79 10 1 Y 1 A SER 788 ? A SER 80 11 1 Y 1 A HIS 789 ? A HIS 81 12 1 Y 1 A HIS 790 ? A HIS 82 13 1 Y 1 A HIS 791 ? A HIS 83 14 1 Y 1 A HIS 792 ? A HIS 84 15 1 Y 1 A HIS 793 ? A HIS 85 16 1 Y 1 A HIS 794 ? A HIS 86 17 2 Y 1 A MET 709 ? A MET 1 18 2 Y 1 A GLY 710 ? A GLY 2 19 2 Y 1 A SER 711 ? A SER 3 20 2 Y 1 A LEU 712 ? A LEU 4 21 2 Y 1 A ASN 713 ? A ASN 5 22 2 Y 1 A GLY 714 ? A GLY 6 23 2 Y 1 A GLY 715 ? A GLY 7 24 2 Y 1 A SER 716 ? A SER 8 25 2 Y 1 A GLY 787 ? A GLY 79 26 2 Y 1 A SER 788 ? A SER 80 27 2 Y 1 A HIS 789 ? A HIS 81 28 2 Y 1 A HIS 790 ? A HIS 82 29 2 Y 1 A HIS 791 ? A HIS 83 30 2 Y 1 A HIS 792 ? A HIS 84 31 2 Y 1 A HIS 793 ? A HIS 85 32 2 Y 1 A HIS 794 ? A HIS 86 33 3 Y 1 A MET 709 ? A MET 1 34 3 Y 1 A GLY 710 ? A GLY 2 35 3 Y 1 A SER 711 ? A SER 3 36 3 Y 1 A LEU 712 ? A LEU 4 37 3 Y 1 A ASN 713 ? A ASN 5 38 3 Y 1 A GLY 714 ? A GLY 6 39 3 Y 1 A GLY 715 ? A GLY 7 40 3 Y 1 A SER 716 ? A SER 8 41 3 Y 1 A GLY 787 ? A GLY 79 42 3 Y 1 A SER 788 ? A SER 80 43 3 Y 1 A HIS 789 ? A HIS 81 44 3 Y 1 A HIS 790 ? A HIS 82 45 3 Y 1 A HIS 791 ? A HIS 83 46 3 Y 1 A HIS 792 ? A HIS 84 47 3 Y 1 A HIS 793 ? A HIS 85 48 3 Y 1 A HIS 794 ? A HIS 86 49 4 Y 1 A MET 709 ? A MET 1 50 4 Y 1 A GLY 710 ? A GLY 2 51 4 Y 1 A SER 711 ? A SER 3 52 4 Y 1 A LEU 712 ? A LEU 4 53 4 Y 1 A ASN 713 ? A ASN 5 54 4 Y 1 A GLY 714 ? A GLY 6 55 4 Y 1 A GLY 715 ? A GLY 7 56 4 Y 1 A SER 716 ? A SER 8 57 4 Y 1 A GLY 787 ? A GLY 79 58 4 Y 1 A SER 788 ? A SER 80 59 4 Y 1 A HIS 789 ? A HIS 81 60 4 Y 1 A HIS 790 ? A HIS 82 61 4 Y 1 A HIS 791 ? A HIS 83 62 4 Y 1 A HIS 792 ? A HIS 84 63 4 Y 1 A HIS 793 ? A HIS 85 64 4 Y 1 A HIS 794 ? A HIS 86 65 5 Y 1 A MET 709 ? A MET 1 66 5 Y 1 A GLY 710 ? A GLY 2 67 5 Y 1 A SER 711 ? A SER 3 68 5 Y 1 A LEU 712 ? A LEU 4 69 5 Y 1 A ASN 713 ? A ASN 5 70 5 Y 1 A GLY 714 ? A GLY 6 71 5 Y 1 A GLY 715 ? A GLY 7 72 5 Y 1 A SER 716 ? A SER 8 73 5 Y 1 A GLY 787 ? A GLY 79 74 5 Y 1 A SER 788 ? A SER 80 75 5 Y 1 A HIS 789 ? A HIS 81 76 5 Y 1 A HIS 790 ? A HIS 82 77 5 Y 1 A HIS 791 ? A HIS 83 78 5 Y 1 A HIS 792 ? A HIS 84 79 5 Y 1 A HIS 793 ? A HIS 85 80 5 Y 1 A HIS 794 ? A HIS 86 81 6 Y 1 A MET 709 ? A MET 1 82 6 Y 1 A GLY 710 ? A GLY 2 83 6 Y 1 A SER 711 ? A SER 3 84 6 Y 1 A LEU 712 ? A LEU 4 85 6 Y 1 A ASN 713 ? A ASN 5 86 6 Y 1 A GLY 714 ? A GLY 6 87 6 Y 1 A GLY 715 ? A GLY 7 88 6 Y 1 A SER 716 ? A SER 8 89 6 Y 1 A GLY 787 ? A GLY 79 90 6 Y 1 A SER 788 ? A SER 80 91 6 Y 1 A HIS 789 ? A HIS 81 92 6 Y 1 A HIS 790 ? A HIS 82 93 6 Y 1 A HIS 791 ? A HIS 83 94 6 Y 1 A HIS 792 ? A HIS 84 95 6 Y 1 A HIS 793 ? A HIS 85 96 6 Y 1 A HIS 794 ? A HIS 86 97 7 Y 1 A MET 709 ? A MET 1 98 7 Y 1 A GLY 710 ? A GLY 2 99 7 Y 1 A SER 711 ? A SER 3 100 7 Y 1 A LEU 712 ? A LEU 4 101 7 Y 1 A ASN 713 ? A ASN 5 102 7 Y 1 A GLY 714 ? A GLY 6 103 7 Y 1 A GLY 715 ? A GLY 7 104 7 Y 1 A SER 716 ? A SER 8 105 7 Y 1 A GLY 787 ? A GLY 79 106 7 Y 1 A SER 788 ? A SER 80 107 7 Y 1 A HIS 789 ? A HIS 81 108 7 Y 1 A HIS 790 ? A HIS 82 109 7 Y 1 A HIS 791 ? A HIS 83 110 7 Y 1 A HIS 792 ? A HIS 84 111 7 Y 1 A HIS 793 ? A HIS 85 112 7 Y 1 A HIS 794 ? A HIS 86 113 8 Y 1 A MET 709 ? A MET 1 114 8 Y 1 A GLY 710 ? A GLY 2 115 8 Y 1 A SER 711 ? A SER 3 116 8 Y 1 A LEU 712 ? A LEU 4 117 8 Y 1 A ASN 713 ? A ASN 5 118 8 Y 1 A GLY 714 ? A GLY 6 119 8 Y 1 A GLY 715 ? A GLY 7 120 8 Y 1 A SER 716 ? A SER 8 121 8 Y 1 A GLY 787 ? A GLY 79 122 8 Y 1 A SER 788 ? A SER 80 123 8 Y 1 A HIS 789 ? A HIS 81 124 8 Y 1 A HIS 790 ? A HIS 82 125 8 Y 1 A HIS 791 ? A HIS 83 126 8 Y 1 A HIS 792 ? A HIS 84 127 8 Y 1 A HIS 793 ? A HIS 85 128 8 Y 1 A HIS 794 ? A HIS 86 129 9 Y 1 A MET 709 ? A MET 1 130 9 Y 1 A GLY 710 ? A GLY 2 131 9 Y 1 A SER 711 ? A SER 3 132 9 Y 1 A LEU 712 ? A LEU 4 133 9 Y 1 A ASN 713 ? A ASN 5 134 9 Y 1 A GLY 714 ? A GLY 6 135 9 Y 1 A GLY 715 ? A GLY 7 136 9 Y 1 A SER 716 ? A SER 8 137 9 Y 1 A GLY 787 ? A GLY 79 138 9 Y 1 A SER 788 ? A SER 80 139 9 Y 1 A HIS 789 ? A HIS 81 140 9 Y 1 A HIS 790 ? A HIS 82 141 9 Y 1 A HIS 791 ? A HIS 83 142 9 Y 1 A HIS 792 ? A HIS 84 143 9 Y 1 A HIS 793 ? A HIS 85 144 9 Y 1 A HIS 794 ? A HIS 86 145 10 Y 1 A MET 709 ? A MET 1 146 10 Y 1 A GLY 710 ? A GLY 2 147 10 Y 1 A SER 711 ? A SER 3 148 10 Y 1 A LEU 712 ? A LEU 4 149 10 Y 1 A ASN 713 ? A ASN 5 150 10 Y 1 A GLY 714 ? A GLY 6 151 10 Y 1 A GLY 715 ? A GLY 7 152 10 Y 1 A SER 716 ? A SER 8 153 10 Y 1 A GLY 787 ? A GLY 79 154 10 Y 1 A SER 788 ? A SER 80 155 10 Y 1 A HIS 789 ? A HIS 81 156 10 Y 1 A HIS 790 ? A HIS 82 157 10 Y 1 A HIS 791 ? A HIS 83 158 10 Y 1 A HIS 792 ? A HIS 84 159 10 Y 1 A HIS 793 ? A HIS 85 160 10 Y 1 A HIS 794 ? A HIS 86 161 11 Y 1 A MET 709 ? A MET 1 162 11 Y 1 A GLY 710 ? A GLY 2 163 11 Y 1 A SER 711 ? A SER 3 164 11 Y 1 A LEU 712 ? A LEU 4 165 11 Y 1 A ASN 713 ? A ASN 5 166 11 Y 1 A GLY 714 ? A GLY 6 167 11 Y 1 A GLY 715 ? A GLY 7 168 11 Y 1 A SER 716 ? A SER 8 169 11 Y 1 A GLY 787 ? A GLY 79 170 11 Y 1 A SER 788 ? A SER 80 171 11 Y 1 A HIS 789 ? A HIS 81 172 11 Y 1 A HIS 790 ? A HIS 82 173 11 Y 1 A HIS 791 ? A HIS 83 174 11 Y 1 A HIS 792 ? A HIS 84 175 11 Y 1 A HIS 793 ? A HIS 85 176 11 Y 1 A HIS 794 ? A HIS 86 177 12 Y 1 A MET 709 ? A MET 1 178 12 Y 1 A GLY 710 ? A GLY 2 179 12 Y 1 A SER 711 ? A SER 3 180 12 Y 1 A LEU 712 ? A LEU 4 181 12 Y 1 A ASN 713 ? A ASN 5 182 12 Y 1 A GLY 714 ? A GLY 6 183 12 Y 1 A GLY 715 ? A GLY 7 184 12 Y 1 A SER 716 ? A SER 8 185 12 Y 1 A GLY 787 ? A GLY 79 186 12 Y 1 A SER 788 ? A SER 80 187 12 Y 1 A HIS 789 ? A HIS 81 188 12 Y 1 A HIS 790 ? A HIS 82 189 12 Y 1 A HIS 791 ? A HIS 83 190 12 Y 1 A HIS 792 ? A HIS 84 191 12 Y 1 A HIS 793 ? A HIS 85 192 12 Y 1 A HIS 794 ? A HIS 86 193 13 Y 1 A MET 709 ? A MET 1 194 13 Y 1 A GLY 710 ? A GLY 2 195 13 Y 1 A SER 711 ? A SER 3 196 13 Y 1 A LEU 712 ? A LEU 4 197 13 Y 1 A ASN 713 ? A ASN 5 198 13 Y 1 A GLY 714 ? A GLY 6 199 13 Y 1 A GLY 715 ? A GLY 7 200 13 Y 1 A SER 716 ? A SER 8 201 13 Y 1 A GLY 787 ? A GLY 79 202 13 Y 1 A SER 788 ? A SER 80 203 13 Y 1 A HIS 789 ? A HIS 81 204 13 Y 1 A HIS 790 ? A HIS 82 205 13 Y 1 A HIS 791 ? A HIS 83 206 13 Y 1 A HIS 792 ? A HIS 84 207 13 Y 1 A HIS 793 ? A HIS 85 208 13 Y 1 A HIS 794 ? A HIS 86 209 14 Y 1 A MET 709 ? A MET 1 210 14 Y 1 A GLY 710 ? A GLY 2 211 14 Y 1 A SER 711 ? A SER 3 212 14 Y 1 A LEU 712 ? A LEU 4 213 14 Y 1 A ASN 713 ? A ASN 5 214 14 Y 1 A GLY 714 ? A GLY 6 215 14 Y 1 A GLY 715 ? A GLY 7 216 14 Y 1 A SER 716 ? A SER 8 217 14 Y 1 A GLY 787 ? A GLY 79 218 14 Y 1 A SER 788 ? A SER 80 219 14 Y 1 A HIS 789 ? A HIS 81 220 14 Y 1 A HIS 790 ? A HIS 82 221 14 Y 1 A HIS 791 ? A HIS 83 222 14 Y 1 A HIS 792 ? A HIS 84 223 14 Y 1 A HIS 793 ? A HIS 85 224 14 Y 1 A HIS 794 ? A HIS 86 225 15 Y 1 A MET 709 ? A MET 1 226 15 Y 1 A GLY 710 ? A GLY 2 227 15 Y 1 A SER 711 ? A SER 3 228 15 Y 1 A LEU 712 ? A LEU 4 229 15 Y 1 A ASN 713 ? A ASN 5 230 15 Y 1 A GLY 714 ? A GLY 6 231 15 Y 1 A GLY 715 ? A GLY 7 232 15 Y 1 A SER 716 ? A SER 8 233 15 Y 1 A GLY 787 ? A GLY 79 234 15 Y 1 A SER 788 ? A SER 80 235 15 Y 1 A HIS 789 ? A HIS 81 236 15 Y 1 A HIS 790 ? A HIS 82 237 15 Y 1 A HIS 791 ? A HIS 83 238 15 Y 1 A HIS 792 ? A HIS 84 239 15 Y 1 A HIS 793 ? A HIS 85 240 15 Y 1 A HIS 794 ? A HIS 86 241 16 Y 1 A MET 709 ? A MET 1 242 16 Y 1 A GLY 710 ? A GLY 2 243 16 Y 1 A SER 711 ? A SER 3 244 16 Y 1 A LEU 712 ? A LEU 4 245 16 Y 1 A ASN 713 ? A ASN 5 246 16 Y 1 A GLY 714 ? A GLY 6 247 16 Y 1 A GLY 715 ? A GLY 7 248 16 Y 1 A SER 716 ? A SER 8 249 16 Y 1 A GLY 787 ? A GLY 79 250 16 Y 1 A SER 788 ? A SER 80 251 16 Y 1 A HIS 789 ? A HIS 81 252 16 Y 1 A HIS 790 ? A HIS 82 253 16 Y 1 A HIS 791 ? A HIS 83 254 16 Y 1 A HIS 792 ? A HIS 84 255 16 Y 1 A HIS 793 ? A HIS 85 256 16 Y 1 A HIS 794 ? A HIS 86 257 17 Y 1 A MET 709 ? A MET 1 258 17 Y 1 A GLY 710 ? A GLY 2 259 17 Y 1 A SER 711 ? A SER 3 260 17 Y 1 A LEU 712 ? A LEU 4 261 17 Y 1 A ASN 713 ? A ASN 5 262 17 Y 1 A GLY 714 ? A GLY 6 263 17 Y 1 A GLY 715 ? A GLY 7 264 17 Y 1 A SER 716 ? A SER 8 265 17 Y 1 A GLY 787 ? A GLY 79 266 17 Y 1 A SER 788 ? A SER 80 267 17 Y 1 A HIS 789 ? A HIS 81 268 17 Y 1 A HIS 790 ? A HIS 82 269 17 Y 1 A HIS 791 ? A HIS 83 270 17 Y 1 A HIS 792 ? A HIS 84 271 17 Y 1 A HIS 793 ? A HIS 85 272 17 Y 1 A HIS 794 ? A HIS 86 273 18 Y 1 A MET 709 ? A MET 1 274 18 Y 1 A GLY 710 ? A GLY 2 275 18 Y 1 A SER 711 ? A SER 3 276 18 Y 1 A LEU 712 ? A LEU 4 277 18 Y 1 A ASN 713 ? A ASN 5 278 18 Y 1 A GLY 714 ? A GLY 6 279 18 Y 1 A GLY 715 ? A GLY 7 280 18 Y 1 A SER 716 ? A SER 8 281 18 Y 1 A GLY 787 ? A GLY 79 282 18 Y 1 A SER 788 ? A SER 80 283 18 Y 1 A HIS 789 ? A HIS 81 284 18 Y 1 A HIS 790 ? A HIS 82 285 18 Y 1 A HIS 791 ? A HIS 83 286 18 Y 1 A HIS 792 ? A HIS 84 287 18 Y 1 A HIS 793 ? A HIS 85 288 18 Y 1 A HIS 794 ? A HIS 86 289 19 Y 1 A MET 709 ? A MET 1 290 19 Y 1 A GLY 710 ? A GLY 2 291 19 Y 1 A SER 711 ? A SER 3 292 19 Y 1 A LEU 712 ? A LEU 4 293 19 Y 1 A ASN 713 ? A ASN 5 294 19 Y 1 A GLY 714 ? A GLY 6 295 19 Y 1 A GLY 715 ? A GLY 7 296 19 Y 1 A SER 716 ? A SER 8 297 19 Y 1 A GLY 787 ? A GLY 79 298 19 Y 1 A SER 788 ? A SER 80 299 19 Y 1 A HIS 789 ? A HIS 81 300 19 Y 1 A HIS 790 ? A HIS 82 301 19 Y 1 A HIS 791 ? A HIS 83 302 19 Y 1 A HIS 792 ? A HIS 84 303 19 Y 1 A HIS 793 ? A HIS 85 304 19 Y 1 A HIS 794 ? A HIS 86 305 20 Y 1 A MET 709 ? A MET 1 306 20 Y 1 A GLY 710 ? A GLY 2 307 20 Y 1 A SER 711 ? A SER 3 308 20 Y 1 A LEU 712 ? A LEU 4 309 20 Y 1 A ASN 713 ? A ASN 5 310 20 Y 1 A GLY 714 ? A GLY 6 311 20 Y 1 A GLY 715 ? A GLY 7 312 20 Y 1 A SER 716 ? A SER 8 313 20 Y 1 A GLY 787 ? A GLY 79 314 20 Y 1 A SER 788 ? A SER 80 315 20 Y 1 A HIS 789 ? A HIS 81 316 20 Y 1 A HIS 790 ? A HIS 82 317 20 Y 1 A HIS 791 ? A HIS 83 318 20 Y 1 A HIS 792 ? A HIS 84 319 20 Y 1 A HIS 793 ? A HIS 85 320 20 Y 1 A HIS 794 ? A HIS 86 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" _pdbx_entity_nonpoly.comp_id DGP #