data_2LRX # _entry.id 2LRX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LRX pdb_00002lrx 10.2210/pdb2lrx/pdb RCSB RCSB102757 ? ? BMRB 18400 ? ? WWPDB D_1000102757 ? ? # _pdbx_database_related.db_id 18400 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LRX _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-04-15 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fuertig, B.' 1 'Doetsch, M.' 2 'Stampfl, S.' 3 'Kontaxis, G.' 4 'Schroeder, R.' 5 # _citation.id primary _citation.title 'Chaperones modulate RNA structural dynamics through anti-folding' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fuertig, B.' 1 ? primary 'Doetsch, M.' 2 ? primary 'Stampfl, S.' 3 ? primary 'Kontaxis, G.' 4 ? primary 'Schroeder, R.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DNA-binding protein stpA' _entity.formula_weight 5039.699 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 90-134' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'H-NS homolog stpA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code RQPRPAKYKFTDVNGETKTWTGQGRTPKPIAQALAEGKSLDDFLI _entity_poly.pdbx_seq_one_letter_code_can RQPRPAKYKFTDVNGETKTWTGQGRTPKPIAQALAEGKSLDDFLI _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 GLN n 1 3 PRO n 1 4 ARG n 1 5 PRO n 1 6 ALA n 1 7 LYS n 1 8 TYR n 1 9 LYS n 1 10 PHE n 1 11 THR n 1 12 ASP n 1 13 VAL n 1 14 ASN n 1 15 GLY n 1 16 GLU n 1 17 THR n 1 18 LYS n 1 19 THR n 1 20 TRP n 1 21 THR n 1 22 GLY n 1 23 GLN n 1 24 GLY n 1 25 ARG n 1 26 THR n 1 27 PRO n 1 28 LYS n 1 29 PRO n 1 30 ILE n 1 31 ALA n 1 32 GLN n 1 33 ALA n 1 34 LEU n 1 35 ALA n 1 36 GLU n 1 37 GLY n 1 38 LYS n 1 39 SER n 1 40 LEU n 1 41 ASP n 1 42 ASP n 1 43 PHE n 1 44 LEU n 1 45 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'stpA, hnsB, b2669, JW2644' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pTWIN-StpA_CTD _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code STPA_ECOLI _struct_ref.pdbx_db_accession P0ACG1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RQPRPAKYKFTDVNGETKTWTGQGRTPKPIAQALAEGKSLDDFLI _struct_ref.pdbx_align_begin 90 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LRX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 45 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0ACG1 _struct_ref_seq.db_align_beg 90 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 134 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 45 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '3D HNCO' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '3D HNHA' 1 7 1 '3D 1H-13C NOESY' 1 8 1 '3D HNCACB' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength .075 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM [U-99% 13C; U-99% 15N] CTD-StpA, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 500 Varian INOVA 2 'Varian INOVA' 600 Bruker AVANCE 3 'Bruker Avance' 700 Bruker AVANCE 4 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LRX _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LRX _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LRX _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 Goddard 'chemical shift assignment' Sparky ? 3 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LRX _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LRX _struct.title 'RNA structural dynamics are modulated through anti-folding by chaperones' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LRX _struct_keywords.pdbx_keywords CHAPERONE _struct_keywords.text 'RNA chaperone, CHAPERONE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 27 ? GLU A 36 ? PRO A 27 GLU A 36 1 ? 10 HELX_P HELX_P2 2 SER A 39 ? PHE A 43 ? SER A 39 PHE A 43 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2LRX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 1 1 ARG ARG A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ILE 45 45 45 ILE ILE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-04-17 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_exptl_sample.component CTD-StpA-1 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 4 ? ? -47.79 102.02 2 1 ALA A 6 ? ? -103.11 -156.99 3 1 ASP A 12 ? ? -48.33 173.79 4 1 GLU A 16 ? ? -67.67 -166.86 5 1 THR A 17 ? ? -163.06 87.66 6 1 THR A 21 ? ? -131.58 -47.09 7 1 GLN A 23 ? ? -78.05 -77.51 8 2 ARG A 4 ? ? -47.80 102.04 9 2 ALA A 6 ? ? -102.16 -160.28 10 2 ASP A 12 ? ? -50.62 177.45 11 2 LYS A 18 ? ? -139.10 -158.14 12 2 THR A 21 ? ? -130.86 -46.59 13 2 GLN A 23 ? ? -78.10 -78.98 14 3 ARG A 4 ? ? -47.53 101.86 15 3 ALA A 6 ? ? -78.29 -160.48 16 3 ASP A 12 ? ? -53.40 -177.40 17 3 LYS A 18 ? ? -141.78 -158.45 18 3 THR A 21 ? ? -130.23 -44.85 19 3 GLN A 23 ? ? -109.16 -143.80 20 4 ARG A 4 ? ? -47.28 101.77 21 4 LYS A 18 ? ? -141.61 -158.99 22 4 GLN A 23 ? ? -80.51 -88.47 23 4 PRO A 27 ? ? -38.50 145.16 24 5 GLN A 2 ? ? -171.56 88.35 25 5 ARG A 4 ? ? -47.35 101.81 26 5 ALA A 6 ? ? -88.51 -152.11 27 5 ASP A 12 ? ? -57.95 172.16 28 5 GLN A 23 ? ? -80.20 -90.67 29 5 PRO A 27 ? ? -38.75 148.06 30 6 GLN A 2 ? ? -55.53 103.82 31 6 ARG A 4 ? ? -47.44 101.87 32 6 ASP A 12 ? ? -51.83 178.88 33 6 THR A 21 ? ? -130.94 -45.78 34 7 ARG A 4 ? ? -47.49 101.87 35 7 ASP A 12 ? ? -49.53 178.29 36 7 GLU A 16 ? ? -69.66 -165.66 37 7 THR A 17 ? ? -158.32 81.38 38 7 GLN A 23 ? ? -78.44 -76.65 39 8 GLN A 2 ? ? -53.81 102.87 40 8 ARG A 4 ? ? -47.73 102.04 41 8 ALA A 6 ? ? -86.78 -149.09 42 8 THR A 21 ? ? -131.23 -46.49 43 9 GLN A 2 ? ? -176.36 89.66 44 9 ARG A 4 ? ? -47.47 101.87 45 9 ALA A 6 ? ? -81.37 -158.11 46 9 ASP A 12 ? ? -50.60 175.43 47 9 LYS A 18 ? ? -141.66 -158.34 48 9 THR A 21 ? ? -131.67 -45.68 49 9 GLN A 23 ? ? -111.37 -145.81 50 10 ARG A 4 ? ? -47.58 101.90 51 10 ALA A 6 ? ? -103.49 -159.04 52 10 ASP A 12 ? ? -49.30 177.66 53 10 GLU A 16 ? ? -67.97 -166.29 54 10 THR A 17 ? ? -160.68 83.19 55 10 GLN A 23 ? ? -78.79 -87.24 56 10 SER A 39 ? ? -109.49 -161.96 #