data_2LS8 # _entry.id 2LS8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LS8 RCSB RCSB102768 BMRB 18415 WWPDB D_1000102768 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified NYSGRC-020344 TargetTrack . unspecified 18415 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LS8 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-04-23 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Harris, R.' 1 'Gaudette, J.' 2 'Bandaranayake, A.D.' 3 'Banu, R.' 4 'Bonanno, J.B.' 5 'Calarese, D.A.' 6 'Celikgil, A.' 7 'Chamala, S.' 8 'Chan, M.K.' 9 'Chaparro, R.' 10 'Evans, B.' 11 'Garforth, S.' 12 'Gizzi, A.' 13 'Hillerich, B.' 14 'Kar, A.' 15 'Lafleur, J.' 16 'Lim, S.' 17 'Love, J.' 18 'Matikainen, B.' 19 'Patel, H.' 20 'Seidel, R.D.' 21 'Smith, B.' 22 'Stead, M.' 23 'Girvin, M.E.' 24 'Almo, S.C.' 25 'New York Structural Genomics Research Consortium (NYSGRC)' 26 # _citation.id primary _citation.title 'Solution structure of human C-type lectin domain family 4 member D' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Harris, R.' 1 primary 'Gaudette, J.' 2 primary 'Bandaranayake, A.D.' 3 primary 'Banu, R.' 4 primary 'Bonanno, J.B.' 5 primary 'Calarese, D.A.' 6 primary 'Celikgil, A.' 7 primary 'Chamala, S.' 8 primary 'Chan, M.K.' 9 primary 'Chaparro, R.' 10 primary 'Evans, B.' 11 primary 'Garforth, S.' 12 primary 'Gizzi, A.' 13 primary 'Hillerich, B.' 14 primary 'Kar, A.' 15 primary 'Lafleur, J.' 16 primary 'Lim, S.' 17 primary 'Love, J.' 18 primary 'Matikainen, B.' 19 primary 'Patel, H.' 20 primary 'Seidel, R.D.' 21 primary 'Smith, B.' 22 primary 'Stead, M.' 23 primary 'Girvin, M.E.' 24 primary 'Almo, S.C.' 25 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'C-type lectin domain family 4 member D' _entity.formula_weight 18610.725 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 84-215' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'C-type lectin superfamily member 8, C-type lectin-like receptor 6, CLEC-6' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTP FNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLNAENLYFQSHHHHHHWSHPQFEK ; _entity_poly.pdbx_seq_one_letter_code_can ;MVCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTP FNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLNAENLYFQSHHHHHHWSHPQFEK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGRC-020344 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 CYS n 1 4 PRO n 1 5 ILE n 1 6 ASP n 1 7 TRP n 1 8 ARG n 1 9 ALA n 1 10 PHE n 1 11 GLN n 1 12 SER n 1 13 ASN n 1 14 CYS n 1 15 TYR n 1 16 PHE n 1 17 PRO n 1 18 LEU n 1 19 THR n 1 20 ASP n 1 21 ASN n 1 22 LYS n 1 23 THR n 1 24 TRP n 1 25 ALA n 1 26 GLU n 1 27 SER n 1 28 GLU n 1 29 ARG n 1 30 ASN n 1 31 CYS n 1 32 SER n 1 33 GLY n 1 34 MET n 1 35 GLY n 1 36 ALA n 1 37 HIS n 1 38 LEU n 1 39 MET n 1 40 THR n 1 41 ILE n 1 42 SER n 1 43 THR n 1 44 GLU n 1 45 ALA n 1 46 GLU n 1 47 GLN n 1 48 ASN n 1 49 PHE n 1 50 ILE n 1 51 ILE n 1 52 GLN n 1 53 PHE n 1 54 LEU n 1 55 ASP n 1 56 ARG n 1 57 ARG n 1 58 LEU n 1 59 SER n 1 60 TYR n 1 61 PHE n 1 62 LEU n 1 63 GLY n 1 64 LEU n 1 65 ARG n 1 66 ASP n 1 67 GLU n 1 68 ASN n 1 69 ALA n 1 70 LYS n 1 71 GLY n 1 72 GLN n 1 73 TRP n 1 74 ARG n 1 75 TRP n 1 76 VAL n 1 77 ASP n 1 78 GLN n 1 79 THR n 1 80 PRO n 1 81 PHE n 1 82 ASN n 1 83 PRO n 1 84 ARG n 1 85 ARG n 1 86 VAL n 1 87 PHE n 1 88 TRP n 1 89 HIS n 1 90 LYS n 1 91 ASN n 1 92 GLU n 1 93 PRO n 1 94 ASP n 1 95 ASN n 1 96 SER n 1 97 GLN n 1 98 GLY n 1 99 GLU n 1 100 ASN n 1 101 CYS n 1 102 VAL n 1 103 VAL n 1 104 LEU n 1 105 VAL n 1 106 TYR n 1 107 ASN n 1 108 GLN n 1 109 ASP n 1 110 LYS n 1 111 TRP n 1 112 ALA n 1 113 TRP n 1 114 ASN n 1 115 ASP n 1 116 VAL n 1 117 PRO n 1 118 CYS n 1 119 ASN n 1 120 PHE n 1 121 GLU n 1 122 ALA n 1 123 SER n 1 124 ARG n 1 125 ILE n 1 126 CYS n 1 127 LYS n 1 128 ILE n 1 129 PRO n 1 130 GLY n 1 131 THR n 1 132 THR n 1 133 LEU n 1 134 ASN n 1 135 ALA n 1 136 GLU n 1 137 ASN n 1 138 LEU n 1 139 TYR n 1 140 PHE n 1 141 GLN n 1 142 SER n 1 143 HIS n 1 144 HIS n 1 145 HIS n 1 146 HIS n 1 147 HIS n 1 148 HIS n 1 149 TRP n 1 150 SER n 1 151 HIS n 1 152 PRO n 1 153 GLN n 1 154 PHE n 1 155 GLU n 1 156 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CLEC4D, CLECSF8, MCL' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'modified pET23a' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CLC4D_HUMAN _struct_ref.pdbx_db_accession Q8WXI8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;CPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFN PRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN ; _struct_ref.pdbx_align_begin 84 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LS8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8WXI8 _struct_ref_seq.db_align_beg 84 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 215 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 134 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LS8 MET A 1 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 1 1 1 2LS8 VAL A 2 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 2 2 1 2LS8 ALA A 135 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 135 3 1 2LS8 GLU A 136 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 136 4 1 2LS8 ASN A 137 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 137 5 1 2LS8 LEU A 138 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 138 6 1 2LS8 TYR A 139 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 139 7 1 2LS8 PHE A 140 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 140 8 1 2LS8 GLN A 141 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 141 9 1 2LS8 SER A 142 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 142 10 1 2LS8 HIS A 143 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 143 11 1 2LS8 HIS A 144 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 144 12 1 2LS8 HIS A 145 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 145 13 1 2LS8 HIS A 146 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 146 14 1 2LS8 HIS A 147 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 147 15 1 2LS8 HIS A 148 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 148 16 1 2LS8 TRP A 149 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 149 17 1 2LS8 SER A 150 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 150 18 1 2LS8 HIS A 151 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 151 19 1 2LS8 PRO A 152 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 152 20 1 2LS8 GLN A 153 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 153 21 1 2LS8 PHE A 154 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 154 22 1 2LS8 GLU A 155 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 155 23 1 2LS8 LYS A 156 ? UNP Q8WXI8 ? ? 'EXPRESSION TAG' 156 24 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '15N HSQC' 1 2 1 '15N NOESY-HSQC' 1 3 2 '13C CT-HSQC' 1 4 2 'aromatic 13C CT-HSQC' 1 5 2 '13C NOESY-HSQC' 1 6 2 '13C aromatic NOESY-HSQC' 1 7 1 HNCO 1 8 1 HNCACO 1 9 1 HNCA 1 10 1 HNCOCA 1 11 1 HNCACB 1 12 1 CBCACONH # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 10 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-13C; U-15N] C-type lectin, 10 mM sodium acetate, 0.1 mM EDTA, 90% H2O, 10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-13C; U-15N] C-type lectin, 10 mM sodium acetate, 0.1 mM EDTA, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian Inova' 800 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LS8 _pdbx_nmr_refine.method 'simulating annealing' _pdbx_nmr_refine.details 'Refinement in a box of water' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria '20 structures for lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LS8 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LS8 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal CCPN 'chemical shift assignment' CCPN 2.1.5 1 CCPN 'peak picking' CCPN 2.1.5 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.21 3 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.21 4 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 2.3 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 5.4 6 Varian collection VNMRJ 2.2D 7 'Bruker Biospin' collection TOPSPIN ? 8 'Orekhov, Jaravine, Kazimierczuk' collection MDDNMR 2.0 9 'Orekhov, Jaravine, Kazimierczuk' processing MDDNMR 2.0 10 'Lemak, Gutmanas, Chitayat, Karra, Fares, Sunnerhagen, Arrowsmith' collection MDDGUI 1.0 11 'Lemak, Gutmanas, Chitayat, Karra, Fares, Sunnerhagen, Arrowsmith' processing MDDGUI 1.0 12 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LS8 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LS8 _struct.title 'Solution structure of human C-type lectin domain family 4 member D' _struct.pdbx_descriptor 'C-type lectin domain family 4 member D' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LS8 _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text 'STRUCTURAL GENOMICS, New York Structural Genomics Research Consortium, NYSGRC, PSI-Biology, IMMUNE SYSTEM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 23 ? CYS A 31 ? THR A 23 CYS A 31 1 ? 9 HELX_P HELX_P2 2 THR A 43 ? ILE A 51 ? THR A 43 ILE A 51 1 ? 9 HELX_P HELX_P3 3 GLY A 130 ? LEU A 133 ? GLY A 130 LEU A 133 5 ? 4 HELX_P HELX_P4 4 ASN A 134 ? SER A 142 ? ASN A 134 SER A 142 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 14 SG ? ? A CYS 3 A CYS 14 1_555 ? ? ? ? ? ? ? 2.018 ? disulf2 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 126 SG ? ? A CYS 31 A CYS 126 1_555 ? ? ? ? ? ? ? 2.021 ? disulf3 disulf ? ? A CYS 101 SG ? ? ? 1_555 A CYS 118 SG ? ? A CYS 101 A CYS 118 1_555 ? ? ? ? ? ? ? 2.016 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 8 ? PHE A 10 ? ARG A 8 PHE A 10 A 2 ASN A 13 ? LYS A 22 ? ASN A 13 LYS A 22 A 3 ALA A 122 ? ILE A 128 ? ALA A 122 ILE A 128 A 4 SER A 59 ? ASP A 66 ? SER A 59 ASP A 66 A 5 ARG A 74 ? TRP A 75 ? ARG A 74 TRP A 75 B 1 HIS A 37 ? LEU A 38 ? HIS A 37 LEU A 38 B 2 ALA A 122 ? ILE A 128 ? ALA A 122 ILE A 128 B 3 SER A 59 ? ASP A 66 ? SER A 59 ASP A 66 B 4 ASN A 100 ? ASN A 107 ? ASN A 100 ASN A 107 B 5 LYS A 110 ? VAL A 116 ? LYS A 110 VAL A 116 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 8 ? N ARG A 8 O TYR A 15 ? O TYR A 15 A 2 3 N LEU A 18 ? N LEU A 18 O ARG A 124 ? O ARG A 124 A 3 4 O SER A 123 ? O SER A 123 N PHE A 61 ? N PHE A 61 A 4 5 N ARG A 65 ? N ARG A 65 O ARG A 74 ? O ARG A 74 B 1 2 N HIS A 37 ? N HIS A 37 O LYS A 127 ? O LYS A 127 B 2 3 O SER A 123 ? O SER A 123 N PHE A 61 ? N PHE A 61 B 3 4 N TYR A 60 ? N TYR A 60 O LEU A 104 ? O LEU A 104 B 4 5 N CYS A 101 ? N CYS A 101 O VAL A 116 ? O VAL A 116 # _atom_sites.entry_id 2LS8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 TRP 75 75 75 TRP TRP A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 TRP 88 88 88 TRP TRP A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 TRP 111 111 111 TRP TRP A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 TRP 113 113 113 TRP TRP A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 CYS 118 118 118 CYS CYS A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 CYS 126 126 126 CYS CYS A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 HIS 143 143 ? ? ? A . n A 1 144 HIS 144 144 ? ? ? A . n A 1 145 HIS 145 145 ? ? ? A . n A 1 146 HIS 146 146 ? ? ? A . n A 1 147 HIS 147 147 ? ? ? A . n A 1 148 HIS 148 148 ? ? ? A . n A 1 149 TRP 149 149 ? ? ? A . n A 1 150 SER 150 150 ? ? ? A . n A 1 151 HIS 151 151 ? ? ? A . n A 1 152 PRO 152 152 ? ? ? A . n A 1 153 GLN 153 153 ? ? ? A . n A 1 154 PHE 154 154 ? ? ? A . n A 1 155 GLU 155 155 ? ? ? A . n A 1 156 LYS 156 156 ? ? ? A . n # _pdbx_SG_project.full_name_of_center 'New York Structural Genomics Research Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NYSGRC _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2012-05-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'C-type lectin-1' 1 ? mM '[U-13C; U-15N]' 1 'sodium acetate-2' 10 ? mM ? 1 EDTA-3 0.1 ? mM ? 1 'C-type lectin-4' 1 ? mM '[U-13C; U-15N]' 2 'sodium acetate-5' 10 ? mM ? 2 EDTA-6 0.1 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count 9 _pdbx_nmr_constraints.entry_id 2LS8 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 72 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2310 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 668 _pdbx_nmr_constraints.NOE_long_range_total_count 671 _pdbx_nmr_constraints.NOE_medium_range_total_count 349 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 558 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 6 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 81 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 80 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 67 ? ? HZ3 A LYS 70 ? ? 1.58 2 1 HG1 A THR 43 ? ? OE1 A GLU 46 ? ? 1.59 3 1 O A HIS 37 ? ? H A LYS 127 ? ? 1.60 4 2 OE2 A GLU 67 ? ? HZ2 A LYS 70 ? ? 1.57 5 2 OD2 A ASP 55 ? ? HH21 A ARG 57 ? ? 1.59 6 2 OD1 A ASP 66 ? ? HZ3 A LYS 70 ? ? 1.60 7 3 HD3 A LYS 22 ? ? HB3 A GLU 26 ? ? 1.32 8 3 OE1 A GLU 67 ? ? HZ2 A LYS 70 ? ? 1.55 9 3 OD2 A ASP 55 ? ? HH21 A ARG 57 ? ? 1.60 10 4 OD1 A ASP 66 ? ? HZ1 A LYS 70 ? ? 1.55 11 4 HZ2 A LYS 22 ? ? OE1 A GLU 26 ? ? 1.56 12 5 HB3 A ALA 69 ? ? HA2 A GLY 98 ? ? 1.32 13 6 HZ1 A LYS 22 ? ? OE2 A GLU 26 ? ? 1.59 14 6 OE1 A GLU 67 ? ? HZ3 A LYS 70 ? ? 1.59 15 7 OD2 A ASP 77 ? ? HZ3 A LYS 127 ? ? 1.56 16 7 HH21 A ARG 65 ? ? OE2 A GLU 99 ? ? 1.59 17 7 OD2 A ASP 55 ? ? HH21 A ARG 57 ? ? 1.60 18 8 OE2 A GLU 67 ? ? HZ1 A LYS 70 ? ? 1.57 19 8 HH12 A ARG 56 ? ? OD2 A ASP 109 ? ? 1.59 20 9 HG2 A GLU 67 ? ? HD2 A LYS 70 ? ? 1.33 21 9 OE2 A GLU 67 ? ? HZ2 A LYS 70 ? ? 1.58 22 9 H A SER 42 ? ? OE1 A GLU 46 ? ? 1.58 23 9 OE2 A GLU 46 ? ? HZ1 A LYS 127 ? ? 1.58 24 10 OD2 A ASP 20 ? ? HZ1 A LYS 22 ? ? 1.53 25 11 OE1 A GLU 67 ? ? HZ3 A LYS 70 ? ? 1.55 26 11 OD2 A ASP 55 ? ? HH21 A ARG 57 ? ? 1.59 27 12 HG A SER 27 ? ? HD13 A LEU 38 ? ? 1.30 28 13 HB3 A ASN 68 ? ? HZ3 A LYS 70 ? ? 1.26 29 13 HE2 A MET 39 ? ? HD12 A ILE 41 ? ? 1.33 30 13 HZ1 A LYS 90 ? ? OE2 A GLU 92 ? ? 1.53 31 13 OE1 A GLU 67 ? ? HZ1 A LYS 70 ? ? 1.59 32 14 OE2 A GLU 46 ? ? HZ2 A LYS 127 ? ? 1.54 33 14 O A GLY 130 ? ? HG1 A THR 131 ? ? 1.58 34 14 OE1 A GLU 67 ? ? HH22 A ARG 74 ? ? 1.59 35 14 OD2 A ASP 20 ? ? HZ3 A LYS 22 ? ? 1.59 36 14 HZ1 A LYS 90 ? ? OE2 A GLU 92 ? ? 1.59 37 15 HH12 A ARG 56 ? ? OD1 A ASP 109 ? ? 1.58 38 16 OE2 A GLU 67 ? ? HZ1 A LYS 70 ? ? 1.56 39 16 O A HIS 37 ? ? H A LYS 127 ? ? 1.59 40 17 OE2 A GLU 46 ? ? HZ1 A LYS 127 ? ? 1.56 41 17 HG A SER 96 ? ? OD2 A ASP 115 ? ? 1.56 42 17 OE2 A GLU 67 ? ? HZ2 A LYS 70 ? ? 1.56 43 17 OD2 A ASP 55 ? ? HH21 A ARG 57 ? ? 1.58 44 17 HH12 A ARG 65 ? ? OE1 A GLU 67 ? ? 1.59 45 17 O A ASN 21 ? ? HZ1 A LYS 22 ? ? 1.60 46 18 OD1 A ASP 20 ? ? HZ3 A LYS 22 ? ? 1.54 47 19 HB3 A HIS 89 ? ? HB2 A GLU 92 ? ? 1.30 48 19 H2 A MET 1 ? ? OD1 A ASP 6 ? ? 1.59 49 19 OE2 A GLU 67 ? ? HZ2 A LYS 70 ? ? 1.59 50 20 OE2 A GLU 46 ? ? HZ3 A LYS 127 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 5 ? ? 65.15 -98.11 2 1 GLN A 11 ? ? 60.02 -99.57 3 1 SER A 32 ? ? 75.86 -44.99 4 1 MET A 39 ? ? -53.85 102.33 5 1 ARG A 57 ? ? -162.47 -31.38 6 1 ASN A 68 ? ? 179.87 29.92 7 1 GLN A 72 ? ? -100.39 63.59 8 1 ASP A 77 ? ? -172.88 -59.54 9 1 GLN A 78 ? ? 163.34 -31.83 10 1 LYS A 90 ? ? 175.79 -159.21 11 1 ASP A 94 ? ? 55.17 -97.40 12 1 ASN A 95 ? ? 175.75 -8.73 13 2 GLN A 11 ? ? 67.64 -68.42 14 2 SER A 12 ? ? -145.88 -28.24 15 2 SER A 32 ? ? 75.25 -43.91 16 2 MET A 39 ? ? -52.92 99.40 17 2 ILE A 41 ? ? -55.65 106.08 18 2 ARG A 56 ? ? -79.05 20.21 19 2 GLU A 67 ? ? -74.45 -71.04 20 2 ASN A 68 ? ? -84.67 31.61 21 2 VAL A 76 ? ? 45.77 -80.72 22 2 ASP A 77 ? ? -96.33 -82.50 23 2 LYS A 90 ? ? 81.79 -5.59 24 2 GLU A 99 ? ? 63.20 88.58 25 2 ALA A 135 ? ? -91.27 41.60 26 3 ASP A 6 ? ? 176.68 -51.46 27 3 GLN A 11 ? ? 60.67 -89.11 28 3 SER A 32 ? ? 73.34 -44.92 29 3 MET A 39 ? ? -50.71 103.41 30 3 ILE A 41 ? ? -66.99 95.80 31 3 ALA A 69 ? ? 62.23 87.55 32 3 ASP A 77 ? ? -107.24 -168.78 33 3 PHE A 87 ? ? 66.70 -70.01 34 3 TRP A 88 ? ? 53.49 -158.49 35 3 LYS A 90 ? ? 171.11 -70.90 36 3 ASN A 91 ? ? -140.38 11.75 37 3 PRO A 93 ? ? -101.22 -151.90 38 3 ASN A 95 ? ? -134.67 -37.91 39 3 GLU A 99 ? ? -113.29 74.69 40 3 ALA A 135 ? ? -85.46 31.22 41 4 ASP A 6 ? ? 77.81 -33.79 42 4 GLN A 11 ? ? 58.89 -101.53 43 4 SER A 32 ? ? 80.04 -45.11 44 4 MET A 39 ? ? -40.02 98.68 45 4 ILE A 41 ? ? -59.40 100.72 46 4 ARG A 56 ? ? -90.23 38.82 47 4 ARG A 57 ? ? -142.15 -46.83 48 4 GLU A 67 ? ? -46.81 -78.24 49 4 ALA A 69 ? ? 55.35 70.87 50 4 ASP A 77 ? ? -123.89 -104.74 51 4 LYS A 90 ? ? -177.82 -59.80 52 4 PRO A 93 ? ? -95.82 -154.10 53 4 ASN A 95 ? ? -147.56 -34.66 54 4 SER A 96 ? ? -65.27 97.89 55 4 GLU A 99 ? ? 59.90 74.81 56 4 ASP A 109 ? ? 58.76 4.35 57 4 ALA A 112 ? ? -179.27 -179.40 58 4 ALA A 122 ? ? -162.30 -168.80 59 4 ALA A 135 ? ? -91.52 33.79 60 5 GLN A 11 ? ? 65.60 -73.26 61 5 ASN A 21 ? ? 70.08 116.19 62 5 SER A 32 ? ? 79.46 -43.68 63 5 ARG A 57 ? ? -160.33 -29.95 64 5 ALA A 69 ? ? 69.07 95.94 65 5 ASP A 77 ? ? -94.03 -158.06 66 5 PHE A 87 ? ? -110.37 72.14 67 5 ASP A 109 ? ? 73.68 -17.47 68 5 ALA A 135 ? ? -89.83 38.30 69 6 ASP A 6 ? ? -166.96 -42.61 70 6 GLN A 11 ? ? 66.03 -82.59 71 6 SER A 12 ? ? -152.19 8.64 72 6 SER A 32 ? ? 75.77 -48.48 73 6 MET A 39 ? ? -61.55 96.41 74 6 ALA A 69 ? ? 66.79 92.57 75 6 ASP A 77 ? ? -116.09 79.23 76 6 GLN A 78 ? ? 70.79 -50.00 77 6 PHE A 87 ? ? -115.65 74.50 78 6 HIS A 89 ? ? -89.97 -70.41 79 6 LYS A 90 ? ? 166.96 -30.12 80 6 SER A 96 ? ? -51.06 108.79 81 6 GLU A 99 ? ? 55.75 83.93 82 6 ALA A 135 ? ? -89.96 44.75 83 7 ASP A 6 ? ? 81.40 -18.51 84 7 GLN A 11 ? ? 61.44 -82.64 85 7 SER A 32 ? ? 73.59 -43.00 86 7 ILE A 41 ? ? -58.50 104.23 87 7 GLU A 67 ? ? -145.03 26.77 88 7 ASN A 68 ? ? -179.54 14.27 89 7 GLN A 78 ? ? 72.36 -12.31 90 7 PHE A 87 ? ? 68.44 -65.19 91 7 TRP A 88 ? ? 53.89 -169.06 92 7 LYS A 90 ? ? 83.56 -5.21 93 7 ASN A 91 ? ? -168.92 72.48 94 7 GLN A 97 ? ? -69.47 95.44 95 7 ASP A 109 ? ? 72.00 -3.04 96 7 THR A 131 ? ? 58.98 -12.07 97 8 GLN A 11 ? ? 67.68 -71.59 98 8 SER A 12 ? ? -145.88 13.53 99 8 SER A 32 ? ? 76.88 -33.94 100 8 MET A 39 ? ? -58.54 103.73 101 8 ARG A 57 ? ? -162.54 -29.32 102 8 GLU A 67 ? ? -145.02 -1.79 103 8 ASN A 68 ? ? -157.32 26.22 104 8 GLN A 78 ? ? 76.53 -19.72 105 8 LYS A 90 ? ? -154.65 -79.99 106 8 ASN A 91 ? ? -153.68 23.45 107 8 ASN A 95 ? ? -170.82 92.83 108 8 ASP A 109 ? ? 73.44 -28.30 109 8 ASN A 119 ? ? -94.66 53.21 110 8 THR A 131 ? ? -61.21 2.71 111 8 ALA A 135 ? ? -92.45 35.46 112 9 GLN A 11 ? ? 58.78 -96.51 113 9 SER A 32 ? ? 73.56 -45.79 114 9 MET A 39 ? ? -49.60 109.60 115 9 ARG A 57 ? ? -132.21 -56.36 116 9 ASN A 68 ? ? -161.42 71.30 117 9 ASP A 77 ? ? -50.89 -77.88 118 9 GLN A 78 ? ? -153.61 -18.07 119 9 ASN A 91 ? ? 160.58 -51.99 120 9 GLU A 92 ? ? 35.66 94.78 121 9 PRO A 93 ? ? -61.18 99.42 122 9 ALA A 135 ? ? -89.14 40.56 123 10 GLN A 11 ? ? 69.55 -61.98 124 10 SER A 12 ? ? -152.31 -25.83 125 10 SER A 32 ? ? 76.88 -46.54 126 10 MET A 39 ? ? -48.88 108.64 127 10 ARG A 57 ? ? -161.90 -30.93 128 10 ALA A 69 ? ? 62.27 84.74 129 10 GLN A 78 ? ? 69.36 -48.59 130 10 ARG A 85 ? ? -114.28 70.49 131 10 TRP A 88 ? ? 59.11 -165.02 132 10 LYS A 90 ? ? 173.27 -36.63 133 10 ASN A 95 ? ? 175.60 -44.80 134 10 ASP A 109 ? ? 72.82 -14.61 135 11 GLN A 11 ? ? 63.74 -81.25 136 11 SER A 32 ? ? 74.02 -40.15 137 11 ARG A 57 ? ? -154.16 -32.68 138 11 ASN A 68 ? ? -163.95 17.25 139 11 ASP A 77 ? ? -98.89 -80.79 140 11 GLN A 78 ? ? -160.14 -23.77 141 11 HIS A 89 ? ? -108.74 -166.25 142 11 ASN A 91 ? ? 61.45 76.57 143 11 ASN A 100 ? ? 78.27 118.16 144 11 ASP A 109 ? ? 59.55 17.79 145 11 THR A 131 ? ? 62.96 -14.46 146 12 PRO A 4 ? ? -48.48 150.20 147 12 GLN A 11 ? ? 63.73 -82.89 148 12 SER A 32 ? ? 78.98 -43.39 149 12 ASN A 68 ? ? 71.94 36.30 150 12 ALA A 69 ? ? 62.34 67.21 151 12 GLN A 78 ? ? 81.04 6.36 152 12 LYS A 90 ? ? 176.55 -75.39 153 12 ASP A 94 ? ? 67.57 -161.00 154 12 GLN A 97 ? ? -138.99 -157.32 155 12 GLU A 99 ? ? 72.30 61.98 156 12 ASP A 109 ? ? 53.05 18.91 157 13 GLN A 11 ? ? 57.48 -94.77 158 13 SER A 12 ? ? -141.03 27.72 159 13 SER A 32 ? ? 166.13 -60.42 160 13 ILE A 41 ? ? -55.12 106.33 161 13 ARG A 56 ? ? -68.98 57.95 162 13 ARG A 57 ? ? -158.20 -33.50 163 13 GLU A 67 ? ? -87.72 31.28 164 13 ASN A 68 ? ? 179.05 137.17 165 13 ALA A 69 ? ? -62.51 87.51 166 13 GLN A 72 ? ? -154.26 44.68 167 13 TRP A 73 ? ? -37.11 117.00 168 13 GLN A 78 ? ? 68.29 -56.45 169 13 LYS A 90 ? ? -155.48 -41.03 170 13 ASN A 91 ? ? -171.37 65.50 171 13 PRO A 93 ? ? -94.94 -149.11 172 13 ASN A 95 ? ? -133.81 -50.04 173 13 GLU A 99 ? ? -105.12 -148.81 174 13 ASN A 100 ? ? -165.64 -91.85 175 13 CYS A 101 ? ? 66.80 116.46 176 13 ASP A 109 ? ? 71.31 -25.46 177 13 ALA A 135 ? ? -90.14 40.06 178 14 ILE A 5 ? ? 56.88 -98.84 179 14 GLN A 11 ? ? 66.76 -70.70 180 14 SER A 12 ? ? -142.35 -11.57 181 14 SER A 32 ? ? 79.62 -43.65 182 14 MET A 39 ? ? -46.51 104.19 183 14 ARG A 56 ? ? -80.28 30.17 184 14 ASN A 68 ? ? 72.26 -66.74 185 14 ALA A 69 ? ? -179.82 80.26 186 14 LYS A 70 ? ? -101.51 -61.60 187 14 GLN A 78 ? ? 79.29 -8.18 188 14 ARG A 84 ? ? -89.83 34.41 189 14 ARG A 85 ? ? -140.43 21.73 190 14 LYS A 90 ? ? -131.07 -68.74 191 14 ASN A 91 ? ? 179.65 52.49 192 14 GLU A 99 ? ? 43.17 92.94 193 14 ALA A 122 ? ? -162.91 -167.62 194 14 THR A 131 ? ? 61.93 -31.76 195 15 GLN A 11 ? ? 58.31 -97.35 196 15 SER A 32 ? ? 74.96 -50.65 197 15 ARG A 56 ? ? -75.86 24.67 198 15 ASN A 68 ? ? 76.09 -63.79 199 15 ALA A 69 ? ? 179.30 77.99 200 15 GLN A 72 ? ? -154.40 66.14 201 15 VAL A 76 ? ? 28.25 -72.72 202 15 ASP A 77 ? ? -78.85 -86.75 203 15 GLN A 78 ? ? -145.99 -1.72 204 15 ARG A 84 ? ? -130.39 -34.53 205 15 GLU A 99 ? ? 44.45 84.61 206 15 ASP A 109 ? ? 74.31 -25.45 207 16 ASP A 6 ? ? -172.81 -52.48 208 16 GLN A 11 ? ? 64.00 -82.21 209 16 SER A 32 ? ? 76.85 -47.19 210 16 MET A 39 ? ? -49.77 108.47 211 16 ASN A 68 ? ? 78.70 -45.29 212 16 ALA A 69 ? ? 165.14 -6.34 213 16 LYS A 70 ? ? -68.09 94.03 214 16 ASP A 77 ? ? -100.69 -60.05 215 16 GLN A 78 ? ? -170.24 -21.57 216 16 LYS A 90 ? ? -107.21 59.21 217 16 ASN A 91 ? ? -155.05 -53.67 218 16 PRO A 93 ? ? -93.66 -65.23 219 16 GLU A 99 ? ? -133.48 -43.22 220 16 ASN A 100 ? ? 69.53 123.44 221 16 ASP A 109 ? ? 78.82 -16.22 222 17 GLN A 11 ? ? 56.76 -129.60 223 17 ASP A 20 ? ? 82.44 -168.10 224 17 SER A 32 ? ? 154.31 -65.06 225 17 MET A 39 ? ? -46.65 106.64 226 17 ALA A 69 ? ? 67.99 80.79 227 17 VAL A 76 ? ? -78.33 39.82 228 17 ASP A 77 ? ? -164.74 -160.16 229 17 TRP A 88 ? ? -67.97 -176.05 230 17 HIS A 89 ? ? -101.64 -154.93 231 17 ASN A 91 ? ? -164.25 81.63 232 17 GLU A 99 ? ? 73.07 50.05 233 17 ASP A 109 ? ? 71.18 -11.30 234 17 ALA A 122 ? ? -161.87 -169.24 235 17 THR A 131 ? ? -78.21 33.22 236 18 GLN A 11 ? ? 56.96 -103.57 237 18 SER A 32 ? ? 75.33 -34.82 238 18 MET A 39 ? ? -36.26 111.15 239 18 ALA A 69 ? ? 55.37 75.14 240 18 VAL A 76 ? ? -79.20 47.98 241 18 ASP A 77 ? ? -162.09 32.67 242 18 GLN A 78 ? ? 76.76 -37.29 243 18 ARG A 85 ? ? -105.92 76.91 244 18 LYS A 90 ? ? -58.55 108.48 245 18 ASN A 91 ? ? 61.05 90.13 246 19 ILE A 5 ? ? 60.19 159.45 247 19 GLN A 11 ? ? 66.88 -77.57 248 19 SER A 12 ? ? -149.07 17.33 249 19 SER A 32 ? ? 81.39 -41.23 250 19 ARG A 56 ? ? 64.94 -57.51 251 19 GLN A 78 ? ? 64.88 -64.68 252 19 HIS A 89 ? ? -100.84 56.74 253 19 LYS A 90 ? ? 63.27 -86.95 254 19 PRO A 93 ? ? -98.39 -150.76 255 19 ASN A 95 ? ? -133.52 -152.21 256 19 SER A 96 ? ? 68.29 -163.65 257 19 ALA A 135 ? ? -89.67 39.31 258 20 GLN A 11 ? ? 66.00 -77.50 259 20 SER A 12 ? ? -151.92 30.19 260 20 THR A 19 ? ? -101.16 66.29 261 20 ASP A 20 ? ? 81.42 178.39 262 20 ASN A 21 ? ? 86.57 15.23 263 20 SER A 32 ? ? 71.78 -45.66 264 20 ARG A 56 ? ? -85.48 32.02 265 20 ALA A 69 ? ? 57.94 70.07 266 20 GLN A 72 ? ? -109.43 74.99 267 20 GLN A 78 ? ? 163.44 -29.89 268 20 ASN A 95 ? ? 176.73 101.78 269 20 GLN A 97 ? ? 45.35 25.83 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 143 ? A HIS 143 2 1 Y 1 A HIS 144 ? A HIS 144 3 1 Y 1 A HIS 145 ? A HIS 145 4 1 Y 1 A HIS 146 ? A HIS 146 5 1 Y 1 A HIS 147 ? A HIS 147 6 1 Y 1 A HIS 148 ? A HIS 148 7 1 Y 1 A TRP 149 ? A TRP 149 8 1 Y 1 A SER 150 ? A SER 150 9 1 Y 1 A HIS 151 ? A HIS 151 10 1 Y 1 A PRO 152 ? A PRO 152 11 1 Y 1 A GLN 153 ? A GLN 153 12 1 Y 1 A PHE 154 ? A PHE 154 13 1 Y 1 A GLU 155 ? A GLU 155 14 1 Y 1 A LYS 156 ? A LYS 156 15 2 Y 1 A HIS 143 ? A HIS 143 16 2 Y 1 A HIS 144 ? A HIS 144 17 2 Y 1 A HIS 145 ? A HIS 145 18 2 Y 1 A HIS 146 ? A HIS 146 19 2 Y 1 A HIS 147 ? A HIS 147 20 2 Y 1 A HIS 148 ? A HIS 148 21 2 Y 1 A TRP 149 ? A TRP 149 22 2 Y 1 A SER 150 ? A SER 150 23 2 Y 1 A HIS 151 ? A HIS 151 24 2 Y 1 A PRO 152 ? A PRO 152 25 2 Y 1 A GLN 153 ? A GLN 153 26 2 Y 1 A PHE 154 ? A PHE 154 27 2 Y 1 A GLU 155 ? A GLU 155 28 2 Y 1 A LYS 156 ? A LYS 156 29 3 Y 1 A HIS 143 ? A HIS 143 30 3 Y 1 A HIS 144 ? A HIS 144 31 3 Y 1 A HIS 145 ? A HIS 145 32 3 Y 1 A HIS 146 ? A HIS 146 33 3 Y 1 A HIS 147 ? A HIS 147 34 3 Y 1 A HIS 148 ? A HIS 148 35 3 Y 1 A TRP 149 ? A TRP 149 36 3 Y 1 A SER 150 ? A SER 150 37 3 Y 1 A HIS 151 ? A HIS 151 38 3 Y 1 A PRO 152 ? A PRO 152 39 3 Y 1 A GLN 153 ? A GLN 153 40 3 Y 1 A PHE 154 ? A PHE 154 41 3 Y 1 A GLU 155 ? A GLU 155 42 3 Y 1 A LYS 156 ? A LYS 156 43 4 Y 1 A HIS 143 ? A HIS 143 44 4 Y 1 A HIS 144 ? A HIS 144 45 4 Y 1 A HIS 145 ? A HIS 145 46 4 Y 1 A HIS 146 ? A HIS 146 47 4 Y 1 A HIS 147 ? A HIS 147 48 4 Y 1 A HIS 148 ? A HIS 148 49 4 Y 1 A TRP 149 ? A TRP 149 50 4 Y 1 A SER 150 ? A SER 150 51 4 Y 1 A HIS 151 ? A HIS 151 52 4 Y 1 A PRO 152 ? A PRO 152 53 4 Y 1 A GLN 153 ? A GLN 153 54 4 Y 1 A PHE 154 ? A PHE 154 55 4 Y 1 A GLU 155 ? A GLU 155 56 4 Y 1 A LYS 156 ? A LYS 156 57 5 Y 1 A HIS 143 ? A HIS 143 58 5 Y 1 A HIS 144 ? A HIS 144 59 5 Y 1 A HIS 145 ? A HIS 145 60 5 Y 1 A HIS 146 ? A HIS 146 61 5 Y 1 A HIS 147 ? A HIS 147 62 5 Y 1 A HIS 148 ? A HIS 148 63 5 Y 1 A TRP 149 ? A TRP 149 64 5 Y 1 A SER 150 ? A SER 150 65 5 Y 1 A HIS 151 ? A HIS 151 66 5 Y 1 A PRO 152 ? A PRO 152 67 5 Y 1 A GLN 153 ? A GLN 153 68 5 Y 1 A PHE 154 ? A PHE 154 69 5 Y 1 A GLU 155 ? A GLU 155 70 5 Y 1 A LYS 156 ? A LYS 156 71 6 Y 1 A HIS 143 ? A HIS 143 72 6 Y 1 A HIS 144 ? A HIS 144 73 6 Y 1 A HIS 145 ? A HIS 145 74 6 Y 1 A HIS 146 ? A HIS 146 75 6 Y 1 A HIS 147 ? A HIS 147 76 6 Y 1 A HIS 148 ? A HIS 148 77 6 Y 1 A TRP 149 ? A TRP 149 78 6 Y 1 A SER 150 ? A SER 150 79 6 Y 1 A HIS 151 ? A HIS 151 80 6 Y 1 A PRO 152 ? A PRO 152 81 6 Y 1 A GLN 153 ? A GLN 153 82 6 Y 1 A PHE 154 ? A PHE 154 83 6 Y 1 A GLU 155 ? A GLU 155 84 6 Y 1 A LYS 156 ? A LYS 156 85 7 Y 1 A HIS 143 ? A HIS 143 86 7 Y 1 A HIS 144 ? A HIS 144 87 7 Y 1 A HIS 145 ? A HIS 145 88 7 Y 1 A HIS 146 ? A HIS 146 89 7 Y 1 A HIS 147 ? A HIS 147 90 7 Y 1 A HIS 148 ? A HIS 148 91 7 Y 1 A TRP 149 ? A TRP 149 92 7 Y 1 A SER 150 ? A SER 150 93 7 Y 1 A HIS 151 ? A HIS 151 94 7 Y 1 A PRO 152 ? A PRO 152 95 7 Y 1 A GLN 153 ? A GLN 153 96 7 Y 1 A PHE 154 ? A PHE 154 97 7 Y 1 A GLU 155 ? A GLU 155 98 7 Y 1 A LYS 156 ? A LYS 156 99 8 Y 1 A HIS 143 ? A HIS 143 100 8 Y 1 A HIS 144 ? A HIS 144 101 8 Y 1 A HIS 145 ? A HIS 145 102 8 Y 1 A HIS 146 ? A HIS 146 103 8 Y 1 A HIS 147 ? A HIS 147 104 8 Y 1 A HIS 148 ? A HIS 148 105 8 Y 1 A TRP 149 ? A TRP 149 106 8 Y 1 A SER 150 ? A SER 150 107 8 Y 1 A HIS 151 ? A HIS 151 108 8 Y 1 A PRO 152 ? A PRO 152 109 8 Y 1 A GLN 153 ? A GLN 153 110 8 Y 1 A PHE 154 ? A PHE 154 111 8 Y 1 A GLU 155 ? A GLU 155 112 8 Y 1 A LYS 156 ? A LYS 156 113 9 Y 1 A HIS 143 ? A HIS 143 114 9 Y 1 A HIS 144 ? A HIS 144 115 9 Y 1 A HIS 145 ? A HIS 145 116 9 Y 1 A HIS 146 ? A HIS 146 117 9 Y 1 A HIS 147 ? A HIS 147 118 9 Y 1 A HIS 148 ? A HIS 148 119 9 Y 1 A TRP 149 ? A TRP 149 120 9 Y 1 A SER 150 ? A SER 150 121 9 Y 1 A HIS 151 ? A HIS 151 122 9 Y 1 A PRO 152 ? A PRO 152 123 9 Y 1 A GLN 153 ? A GLN 153 124 9 Y 1 A PHE 154 ? A PHE 154 125 9 Y 1 A GLU 155 ? A GLU 155 126 9 Y 1 A LYS 156 ? A LYS 156 127 10 Y 1 A HIS 143 ? A HIS 143 128 10 Y 1 A HIS 144 ? A HIS 144 129 10 Y 1 A HIS 145 ? A HIS 145 130 10 Y 1 A HIS 146 ? A HIS 146 131 10 Y 1 A HIS 147 ? A HIS 147 132 10 Y 1 A HIS 148 ? A HIS 148 133 10 Y 1 A TRP 149 ? A TRP 149 134 10 Y 1 A SER 150 ? A SER 150 135 10 Y 1 A HIS 151 ? A HIS 151 136 10 Y 1 A PRO 152 ? A PRO 152 137 10 Y 1 A GLN 153 ? A GLN 153 138 10 Y 1 A PHE 154 ? A PHE 154 139 10 Y 1 A GLU 155 ? A GLU 155 140 10 Y 1 A LYS 156 ? A LYS 156 141 11 Y 1 A HIS 143 ? A HIS 143 142 11 Y 1 A HIS 144 ? A HIS 144 143 11 Y 1 A HIS 145 ? A HIS 145 144 11 Y 1 A HIS 146 ? A HIS 146 145 11 Y 1 A HIS 147 ? A HIS 147 146 11 Y 1 A HIS 148 ? A HIS 148 147 11 Y 1 A TRP 149 ? A TRP 149 148 11 Y 1 A SER 150 ? A SER 150 149 11 Y 1 A HIS 151 ? A HIS 151 150 11 Y 1 A PRO 152 ? A PRO 152 151 11 Y 1 A GLN 153 ? A GLN 153 152 11 Y 1 A PHE 154 ? A PHE 154 153 11 Y 1 A GLU 155 ? A GLU 155 154 11 Y 1 A LYS 156 ? A LYS 156 155 12 Y 1 A HIS 143 ? A HIS 143 156 12 Y 1 A HIS 144 ? A HIS 144 157 12 Y 1 A HIS 145 ? A HIS 145 158 12 Y 1 A HIS 146 ? A HIS 146 159 12 Y 1 A HIS 147 ? A HIS 147 160 12 Y 1 A HIS 148 ? A HIS 148 161 12 Y 1 A TRP 149 ? A TRP 149 162 12 Y 1 A SER 150 ? A SER 150 163 12 Y 1 A HIS 151 ? A HIS 151 164 12 Y 1 A PRO 152 ? A PRO 152 165 12 Y 1 A GLN 153 ? A GLN 153 166 12 Y 1 A PHE 154 ? A PHE 154 167 12 Y 1 A GLU 155 ? A GLU 155 168 12 Y 1 A LYS 156 ? A LYS 156 169 13 Y 1 A HIS 143 ? A HIS 143 170 13 Y 1 A HIS 144 ? A HIS 144 171 13 Y 1 A HIS 145 ? A HIS 145 172 13 Y 1 A HIS 146 ? A HIS 146 173 13 Y 1 A HIS 147 ? A HIS 147 174 13 Y 1 A HIS 148 ? A HIS 148 175 13 Y 1 A TRP 149 ? A TRP 149 176 13 Y 1 A SER 150 ? A SER 150 177 13 Y 1 A HIS 151 ? A HIS 151 178 13 Y 1 A PRO 152 ? A PRO 152 179 13 Y 1 A GLN 153 ? A GLN 153 180 13 Y 1 A PHE 154 ? A PHE 154 181 13 Y 1 A GLU 155 ? A GLU 155 182 13 Y 1 A LYS 156 ? A LYS 156 183 14 Y 1 A HIS 143 ? A HIS 143 184 14 Y 1 A HIS 144 ? A HIS 144 185 14 Y 1 A HIS 145 ? A HIS 145 186 14 Y 1 A HIS 146 ? A HIS 146 187 14 Y 1 A HIS 147 ? A HIS 147 188 14 Y 1 A HIS 148 ? A HIS 148 189 14 Y 1 A TRP 149 ? A TRP 149 190 14 Y 1 A SER 150 ? A SER 150 191 14 Y 1 A HIS 151 ? A HIS 151 192 14 Y 1 A PRO 152 ? A PRO 152 193 14 Y 1 A GLN 153 ? A GLN 153 194 14 Y 1 A PHE 154 ? A PHE 154 195 14 Y 1 A GLU 155 ? A GLU 155 196 14 Y 1 A LYS 156 ? A LYS 156 197 15 Y 1 A HIS 143 ? A HIS 143 198 15 Y 1 A HIS 144 ? A HIS 144 199 15 Y 1 A HIS 145 ? A HIS 145 200 15 Y 1 A HIS 146 ? A HIS 146 201 15 Y 1 A HIS 147 ? A HIS 147 202 15 Y 1 A HIS 148 ? A HIS 148 203 15 Y 1 A TRP 149 ? A TRP 149 204 15 Y 1 A SER 150 ? A SER 150 205 15 Y 1 A HIS 151 ? A HIS 151 206 15 Y 1 A PRO 152 ? A PRO 152 207 15 Y 1 A GLN 153 ? A GLN 153 208 15 Y 1 A PHE 154 ? A PHE 154 209 15 Y 1 A GLU 155 ? A GLU 155 210 15 Y 1 A LYS 156 ? A LYS 156 211 16 Y 1 A HIS 143 ? A HIS 143 212 16 Y 1 A HIS 144 ? A HIS 144 213 16 Y 1 A HIS 145 ? A HIS 145 214 16 Y 1 A HIS 146 ? A HIS 146 215 16 Y 1 A HIS 147 ? A HIS 147 216 16 Y 1 A HIS 148 ? A HIS 148 217 16 Y 1 A TRP 149 ? A TRP 149 218 16 Y 1 A SER 150 ? A SER 150 219 16 Y 1 A HIS 151 ? A HIS 151 220 16 Y 1 A PRO 152 ? A PRO 152 221 16 Y 1 A GLN 153 ? A GLN 153 222 16 Y 1 A PHE 154 ? A PHE 154 223 16 Y 1 A GLU 155 ? A GLU 155 224 16 Y 1 A LYS 156 ? A LYS 156 225 17 Y 1 A HIS 143 ? A HIS 143 226 17 Y 1 A HIS 144 ? A HIS 144 227 17 Y 1 A HIS 145 ? A HIS 145 228 17 Y 1 A HIS 146 ? A HIS 146 229 17 Y 1 A HIS 147 ? A HIS 147 230 17 Y 1 A HIS 148 ? A HIS 148 231 17 Y 1 A TRP 149 ? A TRP 149 232 17 Y 1 A SER 150 ? A SER 150 233 17 Y 1 A HIS 151 ? A HIS 151 234 17 Y 1 A PRO 152 ? A PRO 152 235 17 Y 1 A GLN 153 ? A GLN 153 236 17 Y 1 A PHE 154 ? A PHE 154 237 17 Y 1 A GLU 155 ? A GLU 155 238 17 Y 1 A LYS 156 ? A LYS 156 239 18 Y 1 A HIS 143 ? A HIS 143 240 18 Y 1 A HIS 144 ? A HIS 144 241 18 Y 1 A HIS 145 ? A HIS 145 242 18 Y 1 A HIS 146 ? A HIS 146 243 18 Y 1 A HIS 147 ? A HIS 147 244 18 Y 1 A HIS 148 ? A HIS 148 245 18 Y 1 A TRP 149 ? A TRP 149 246 18 Y 1 A SER 150 ? A SER 150 247 18 Y 1 A HIS 151 ? A HIS 151 248 18 Y 1 A PRO 152 ? A PRO 152 249 18 Y 1 A GLN 153 ? A GLN 153 250 18 Y 1 A PHE 154 ? A PHE 154 251 18 Y 1 A GLU 155 ? A GLU 155 252 18 Y 1 A LYS 156 ? A LYS 156 253 19 Y 1 A HIS 143 ? A HIS 143 254 19 Y 1 A HIS 144 ? A HIS 144 255 19 Y 1 A HIS 145 ? A HIS 145 256 19 Y 1 A HIS 146 ? A HIS 146 257 19 Y 1 A HIS 147 ? A HIS 147 258 19 Y 1 A HIS 148 ? A HIS 148 259 19 Y 1 A TRP 149 ? A TRP 149 260 19 Y 1 A SER 150 ? A SER 150 261 19 Y 1 A HIS 151 ? A HIS 151 262 19 Y 1 A PRO 152 ? A PRO 152 263 19 Y 1 A GLN 153 ? A GLN 153 264 19 Y 1 A PHE 154 ? A PHE 154 265 19 Y 1 A GLU 155 ? A GLU 155 266 19 Y 1 A LYS 156 ? A LYS 156 267 20 Y 1 A HIS 143 ? A HIS 143 268 20 Y 1 A HIS 144 ? A HIS 144 269 20 Y 1 A HIS 145 ? A HIS 145 270 20 Y 1 A HIS 146 ? A HIS 146 271 20 Y 1 A HIS 147 ? A HIS 147 272 20 Y 1 A HIS 148 ? A HIS 148 273 20 Y 1 A TRP 149 ? A TRP 149 274 20 Y 1 A SER 150 ? A SER 150 275 20 Y 1 A HIS 151 ? A HIS 151 276 20 Y 1 A PRO 152 ? A PRO 152 277 20 Y 1 A GLN 153 ? A GLN 153 278 20 Y 1 A PHE 154 ? A PHE 154 279 20 Y 1 A GLU 155 ? A GLU 155 280 20 Y 1 A LYS 156 ? A LYS 156 #