data_2LSO # _entry.id 2LSO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LSO pdb_00002lso 10.2210/pdb2lso/pdb RCSB RCSB102784 ? ? BMRB 18438 ? ? WWPDB D_1000102784 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified NESG-HR7057A TargetTrack . unspecified 18438 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LSO _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-05-03 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Eletsky, A.' 1 'Lee, H.' 2 'Lee, D.' 3 'Kohan, E.' 4 'Janjua, H.' 5 'Xiao, R.' 6 'Acton, T.B.' 7 'Everett, J.K.' 8 'Montelione, G.T.' 9 'Prestegard, J.H.' 10 'Szyperski, T.' 11 'Northeast Structural Genomics Consortium (NESG)' 12 # _citation.id primary _citation.title 'Solution NMR Structure of the Globular Domain of Human Histone H1x, Northeast Structural Genomics Consortium (NESG) Target HR7057A' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Eletsky, A.' 1 ? primary 'Lee, H.' 2 ? primary 'Lee, D.' 3 ? primary 'Kohan, E.' 4 ? primary 'Janjua, H.' 5 ? primary 'Xiao, R.' 6 ? primary 'Acton, T.B.' 7 ? primary 'Everett, J.K.' 8 ? primary 'Montelione, G.T.' 9 ? primary 'Prestegard, J.H.' 10 ? primary 'Szyperski, T.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Histone H1x' _entity.formula_weight 9400.785 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'H15 domain residues 44-123' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SHMQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKK LEG ; _entity_poly.pdbx_seq_one_letter_code_can ;SHMQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKK LEG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-HR7057A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 HIS n 1 3 MET n 1 4 GLN n 1 5 PRO n 1 6 GLY n 1 7 LYS n 1 8 TYR n 1 9 SER n 1 10 GLN n 1 11 LEU n 1 12 VAL n 1 13 VAL n 1 14 GLU n 1 15 THR n 1 16 ILE n 1 17 ARG n 1 18 ARG n 1 19 LEU n 1 20 GLY n 1 21 GLU n 1 22 ARG n 1 23 ASN n 1 24 GLY n 1 25 SER n 1 26 SER n 1 27 LEU n 1 28 ALA n 1 29 LYS n 1 30 ILE n 1 31 TYR n 1 32 THR n 1 33 GLU n 1 34 ALA n 1 35 LYS n 1 36 LYS n 1 37 VAL n 1 38 PRO n 1 39 TRP n 1 40 PHE n 1 41 ASP n 1 42 GLN n 1 43 GLN n 1 44 ASN n 1 45 GLY n 1 46 ARG n 1 47 THR n 1 48 TYR n 1 49 LEU n 1 50 LYS n 1 51 TYR n 1 52 SER n 1 53 ILE n 1 54 LYS n 1 55 ALA n 1 56 LEU n 1 57 VAL n 1 58 GLN n 1 59 ASN n 1 60 ASP n 1 61 THR n 1 62 LEU n 1 63 LEU n 1 64 GLN n 1 65 VAL n 1 66 LYS n 1 67 GLY n 1 68 THR n 1 69 GLY n 1 70 ALA n 1 71 ASN n 1 72 GLY n 1 73 SER n 1 74 PHE n 1 75 LYS n 1 76 LEU n 1 77 ASN n 1 78 ARG n 1 79 LYS n 1 80 LYS n 1 81 LEU n 1 82 GLU n 1 83 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene H1FX _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET15Avi6HT_NESG _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code H1X_HUMAN _struct_ref.pdbx_db_accession Q92522 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEG ; _struct_ref.pdbx_align_begin 44 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LSO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q92522 _struct_ref_seq.db_align_beg 44 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 123 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 83 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LSO SER A 1 ? UNP Q92522 ? ? 'expression tag' 1 1 1 2LSO HIS A 2 ? UNP Q92522 ? ? 'expression tag' 2 2 1 2LSO MET A 3 ? UNP Q92522 ? ? 'expression tag' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C CT-HSQC aliphatic' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D (H)CCH-TOCSY aliphatic' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' 1 8 1 '2D 1H-13C CT-HSQC aromatic' 1 9 1 '3D (H)C(CCO)NH-TOCSY' 1 10 1 '3D H(CCCO)NH-TOCSY' 1 11 1 '3D HBHA(CO)NH' 1 12 1 '3D HN(CA)CO' 1 13 1 '3D HCCH-COSY aliphatic' 1 14 1 '3D HCCH-COSY aromatic' 1 15 2 '2D 1H-13C CT-HSQC methyl' 1 16 2 '2D J-resolved 1H-15N HSQC' 1 17 3 '2D J-resolved 1H-15N HSQC' 1 18 1 '1D 15N T1' 1 19 1 '1D 15N T2' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.9 mM [U-100% 13C; U-100% 15N] HR7057A.011, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 50 uM DSS, 0.02 % sodium azide, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.6 mM [5% 13C; U-100% 15N] HR7057A.011, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 50 uM DSS, 0.02 % sodium azide, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' ;0.3 mM [5% 13C; U-100% 15N] HR7057A.011, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 50 uM DSS, 0.02 % sodium azide, 4 % C12E5 PEG, 4 % hexanol, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 750 Varian INOVA 1 'Varian INOVA' 600 Varian INOVA 2 'Varian INOVA' 600 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LSO _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;Structure determination was performed by running CYANA and ASDP in parallel using NOE-based constraints and PHI and PSI dihedral angle constraints from TALOS+. Consensus peak assignments were selected and used in iterative refinement with CYANA, with RDC constraints added at later stages. The 20 conformers out of 100 with the lowest target function were further refined by simulated annealing in explicit water bath using the program CNS with PARAM19 force field ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LSO _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LSO _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.2 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS 1.2 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis' ASDP 1.0 7 'Huang, Tejero, Powers and Montelione' refinement ASDP 1.0 8 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 9 'Bartels et al.' 'data analysis' XEASY 1.3.13 10 Varian collection VnmrJ 2.2D 11 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE 1.0 12 Goddard 'data analysis' Sparky ? 13 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 14 'Bhattacharya, Montelione' 'structure validation' PSVS 1.4 15 'Keller and Wuthrich' 'data analysis' CARA 1.8.4 16 'Keller and Wuthrich' 'chemical shift assignment' CARA 1.8.4 17 'Keller and Wuthrich' 'peak picking' CARA 1.8.4 18 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LSO _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LSO _struct.title 'Solution NMR Structure of the Globular Domain of Human Histone H1x, Northeast Structural Genomics Consortium (NESG) Target HR7057A' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LSO _struct_keywords.pdbx_keywords 'NUCLEAR PROTEIN' _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, PSI-Biology, Protein Structure Initiative, NUCLEAR PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 6 ? GLY A 20 ? GLY A 6 GLY A 20 1 ? 15 HELX_P HELX_P2 2 LEU A 27 ? LYS A 35 ? LEU A 27 LYS A 35 1 ? 9 HELX_P HELX_P3 3 ASN A 44 ? ASN A 59 ? ASN A 44 ASN A 59 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 25 ? SER A 26 ? SER A 25 SER A 26 A 2 SER A 73 ? LEU A 76 ? SER A 73 LEU A 76 A 3 LEU A 62 ? VAL A 65 ? LEU A 62 VAL A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 25 ? N SER A 25 O PHE A 74 ? O PHE A 74 A 2 3 O SER A 73 ? O SER A 73 N VAL A 65 ? N VAL A 65 # _atom_sites.entry_id 2LSO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 GLY 83 83 83 GLY GLY A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-06-13 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' struct_ref 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 6 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id HR7057A.011-1 0.9 ? mM '[U-100% 13C; U-100% 15N]' 1 MES-2 20 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 'calcium chloride-4' 5 ? mM ? 1 DSS-5 50 ? uM ? 1 'sodium azide-6' 0.02 ? % ? 1 HR7057A.011-7 0.6 ? mM '[5% 13C; U-100% 15N]' 2 MES-8 20 ? mM ? 2 'sodium chloride-9' 100 ? mM ? 2 'calcium chloride-10' 5 ? mM ? 2 DSS-11 50 ? uM ? 2 'sodium azide-12' 0.02 ? % ? 2 HR7057A.011-13 0.3 ? mM '[5% 13C; U-100% 15N]' 3 MES-14 20 ? mM ? 3 'sodium chloride-15' 100 ? mM ? 3 'calcium chloride-16' 5 ? mM ? 3 DSS-17 50 ? uM ? 3 'sodium azide-18' 0.02 ? % ? 3 'C12E5 PEG-19' 4 ? % ? 3 hexanol-20 4 ? % ? 3 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LSO _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1597 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 403 _pdbx_nmr_constraints.NOE_long_range_total_count 448 _pdbx_nmr_constraints.NOE_medium_range_total_count 413 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 333 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 38 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 38 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 21 ? ? 49.84 75.36 2 1 GLN A 43 ? ? -89.05 -71.67 3 1 ASN A 77 ? ? -107.20 -66.91 4 1 ARG A 78 ? ? -176.11 -176.72 5 1 LYS A 79 ? ? -82.61 30.88 6 2 LYS A 7 ? ? -130.90 -46.52 7 2 GLU A 21 ? ? 50.17 96.35 8 2 GLN A 43 ? ? -89.67 -71.48 9 2 ALA A 70 ? ? 68.16 -72.09 10 2 LYS A 79 ? ? -86.06 49.17 11 2 GLU A 82 ? ? -150.60 -7.89 12 3 HIS A 2 ? ? -155.72 85.08 13 3 GLN A 43 ? ? -123.95 -64.13 14 3 LYS A 79 ? ? -161.81 31.65 15 4 MET A 3 ? ? 66.15 96.30 16 4 GLN A 43 ? ? -90.14 -65.35 17 4 LYS A 66 ? ? -96.97 36.38 18 4 ARG A 78 ? ? 70.61 -61.07 19 4 LYS A 79 ? ? -78.07 21.11 20 5 HIS A 2 ? ? 54.76 18.14 21 5 PRO A 5 ? ? -92.15 39.37 22 5 LYS A 7 ? ? -81.99 48.13 23 5 GLN A 43 ? ? -82.76 -72.92 24 5 ALA A 70 ? ? -167.70 -76.39 25 6 MET A 3 ? ? 70.76 171.51 26 6 PRO A 5 ? ? -93.01 48.91 27 6 GLN A 43 ? ? -121.60 -68.95 28 6 LYS A 66 ? ? 59.51 -176.56 29 6 ALA A 70 ? ? 59.93 -76.49 30 6 LYS A 79 ? ? -94.72 31.21 31 7 MET A 3 ? ? -153.53 13.61 32 7 ARG A 22 ? ? -52.13 109.51 33 7 ASP A 60 ? ? 57.05 19.59 34 7 ALA A 70 ? ? -48.67 98.66 35 7 ASN A 71 ? ? -166.79 -50.74 36 7 GLU A 82 ? ? -143.61 -41.15 37 8 PRO A 5 ? ? -67.93 86.21 38 8 ARG A 22 ? ? -144.66 11.05 39 8 ASN A 23 ? ? -157.74 -18.27 40 8 ALA A 70 ? ? -81.05 34.28 41 8 LYS A 79 ? ? -95.60 40.02 42 9 GLU A 21 ? ? 58.70 176.07 43 9 ARG A 22 ? ? -141.91 -49.36 44 9 GLN A 43 ? ? -120.99 -64.89 45 9 LYS A 66 ? ? 69.46 -169.17 46 9 ALA A 70 ? ? -158.56 -57.24 47 9 ASN A 71 ? ? -162.39 -71.28 48 9 GLU A 82 ? ? 57.39 -81.45 49 10 MET A 3 ? ? 83.47 -35.50 50 10 GLN A 43 ? ? -83.98 -73.49 51 10 LYS A 66 ? ? 73.07 -176.84 52 10 THR A 68 ? ? -91.46 30.85 53 10 ASN A 71 ? ? 71.09 179.04 54 10 ASN A 77 ? ? -70.02 -76.47 55 10 ARG A 78 ? ? -147.38 47.64 56 10 LYS A 79 ? ? 67.10 -70.02 57 10 LYS A 80 ? ? 72.22 -23.28 58 11 HIS A 2 ? ? -107.25 -88.75 59 11 MET A 3 ? ? -171.93 95.56 60 11 PRO A 5 ? ? -68.87 96.68 61 11 GLN A 43 ? ? -101.76 -62.95 62 11 GLU A 82 ? ? -137.61 -40.02 63 12 ARG A 22 ? ? -136.36 -31.48 64 12 GLN A 43 ? ? -123.03 -74.73 65 12 VAL A 65 ? ? -100.41 77.88 66 12 LYS A 66 ? ? -89.95 33.81 67 12 ALA A 70 ? ? -165.43 26.20 68 12 LYS A 79 ? ? -156.87 43.66 69 13 ASN A 71 ? ? 72.35 -76.89 70 13 GLU A 82 ? ? -107.34 -61.55 71 14 MET A 3 ? ? 55.67 168.83 72 14 PRO A 5 ? ? -68.54 15.41 73 14 LYS A 36 ? ? -88.41 39.24 74 14 LYS A 66 ? ? 66.80 -173.17 75 14 ALA A 70 ? ? -141.27 -66.20 76 14 ARG A 78 ? ? -166.20 -62.05 77 14 LYS A 79 ? ? -163.55 44.93 78 14 LEU A 81 ? ? -60.28 -70.25 79 14 GLU A 82 ? ? 61.07 -71.59 80 15 LYS A 7 ? ? 46.12 -71.62 81 15 GLN A 43 ? ? -108.09 -70.50 82 15 LYS A 66 ? ? -154.62 -29.75 83 15 THR A 68 ? ? -162.86 13.99 84 15 ALA A 70 ? ? 75.84 -37.14 85 15 ASN A 71 ? ? 60.25 95.09 86 16 GLN A 43 ? ? -119.68 -71.13 87 17 MET A 3 ? ? -127.95 -56.41 88 17 GLN A 4 ? ? 65.44 162.97 89 17 PRO A 5 ? ? -69.82 70.98 90 17 GLU A 21 ? ? 65.70 157.08 91 17 ARG A 22 ? ? -104.76 -61.45 92 17 GLN A 43 ? ? -127.88 -71.22 93 17 ALA A 70 ? ? -165.97 -70.71 94 17 ASN A 77 ? ? -92.74 33.20 95 17 ARG A 78 ? ? 63.98 -80.21 96 17 GLU A 82 ? ? 62.49 -73.67 97 18 PRO A 5 ? ? -60.00 96.08 98 18 GLN A 43 ? ? -82.00 -76.92 99 18 ARG A 78 ? ? 74.89 -83.40 100 19 HIS A 2 ? ? 63.50 -170.80 101 20 GLN A 43 ? ? -103.63 -73.05 #