data_2LST # _entry.id 2LST # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LST pdb_00002lst 10.2210/pdb2lst/pdb RCSB RCSB102789 ? ? BMRB 18443 ? 10.13018/BMR18443 WWPDB D_1000102789 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-05-16 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' 7 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LST _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-05-04 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified NYSGRC-011484 TargetTrack . unspecified 18443 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Harris, R.' 1 'Bandaranayake, A.D.' 2 'Banu, R.' 3 'Bonanno, J.B.' 4 'Calarese, D.A.' 5 'Celikgil, A.' 6 'Chamala, S.' 7 'Chan, M.K.' 8 'Chaparro, R.' 9 'Evans, B.' 10 'Garforth, S.' 11 'Gizzi, A.' 12 'Hillerich, B.' 13 'Kar, A.' 14 'Lafleur, J.' 15 'Lim, S.' 16 'Love, J.' 17 'Matikainen, B.' 18 'Patel, H.' 19 'Seidel, R.D.' 20 'Smith, B.' 21 'Stead, M.' 22 'Girvin, M.E.' 23 'Almo, S.C.' 24 'New York Structural Genomics Research Consortium (NYSGRC)' 25 # _citation.id primary _citation.title 'Solution structure of a thioredoxin from Thermus thermophilus' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Harris, R.' 1 ? primary 'Bandaranayake, A.D.' 2 ? primary 'Banu, R.' 3 ? primary 'Bonanno, J.B.' 4 ? primary 'Calarese, D.A.' 5 ? primary 'Celikgil, A.' 6 ? primary 'Chamala, S.' 7 ? primary 'Chan, M.K.' 8 ? primary 'Chaparro, R.' 9 ? primary 'Evans, B.' 10 ? primary 'Garforth, S.' 11 ? primary 'Gizzi, A.' 12 ? primary 'Hillerich, B.' 13 ? primary 'Kar, A.' 14 ? primary 'Lafleur, J.' 15 ? primary 'Lim, S.' 16 ? primary 'Love, J.' 17 ? primary 'Matikainen, B.' 18 ? primary 'Patel, H.' 19 ? primary 'Seidel, R.D.' 20 ? primary 'Smith, B.' 21 ? primary 'Stead, M.' 22 ? primary 'Girvin, M.E.' 23 ? primary 'Almo, S.C.' 24 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Thioredoxin _entity.formula_weight 14739.916 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 35-153' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSLRWYPYPEALALAQAHGRMVMVYFHSEHCPYCQQMNTFVLSDPGVSRLLEARFVVASVSVDTPEGQELARRYRVPGTP TFVFLVPKAGAWEEVGRLFGSRPRAEFLKELRQVCVKGGACGEGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLRWYPYPEALALAQAHGRMVMVYFHSEHCPYCQQMNTFVLSDPGVSRLLEARFVVASVSVDTPEGQELARRYRVPGTP TFVFLVPKAGAWEEVGRLFGSRPRAEFLKELRQVCVKGGACGEGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGRC-011484 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LEU n 1 4 ARG n 1 5 TRP n 1 6 TYR n 1 7 PRO n 1 8 TYR n 1 9 PRO n 1 10 GLU n 1 11 ALA n 1 12 LEU n 1 13 ALA n 1 14 LEU n 1 15 ALA n 1 16 GLN n 1 17 ALA n 1 18 HIS n 1 19 GLY n 1 20 ARG n 1 21 MET n 1 22 VAL n 1 23 MET n 1 24 VAL n 1 25 TYR n 1 26 PHE n 1 27 HIS n 1 28 SER n 1 29 GLU n 1 30 HIS n 1 31 CYS n 1 32 PRO n 1 33 TYR n 1 34 CYS n 1 35 GLN n 1 36 GLN n 1 37 MET n 1 38 ASN n 1 39 THR n 1 40 PHE n 1 41 VAL n 1 42 LEU n 1 43 SER n 1 44 ASP n 1 45 PRO n 1 46 GLY n 1 47 VAL n 1 48 SER n 1 49 ARG n 1 50 LEU n 1 51 LEU n 1 52 GLU n 1 53 ALA n 1 54 ARG n 1 55 PHE n 1 56 VAL n 1 57 VAL n 1 58 ALA n 1 59 SER n 1 60 VAL n 1 61 SER n 1 62 VAL n 1 63 ASP n 1 64 THR n 1 65 PRO n 1 66 GLU n 1 67 GLY n 1 68 GLN n 1 69 GLU n 1 70 LEU n 1 71 ALA n 1 72 ARG n 1 73 ARG n 1 74 TYR n 1 75 ARG n 1 76 VAL n 1 77 PRO n 1 78 GLY n 1 79 THR n 1 80 PRO n 1 81 THR n 1 82 PHE n 1 83 VAL n 1 84 PHE n 1 85 LEU n 1 86 VAL n 1 87 PRO n 1 88 LYS n 1 89 ALA n 1 90 GLY n 1 91 ALA n 1 92 TRP n 1 93 GLU n 1 94 GLU n 1 95 VAL n 1 96 GLY n 1 97 ARG n 1 98 LEU n 1 99 PHE n 1 100 GLY n 1 101 SER n 1 102 ARG n 1 103 PRO n 1 104 ARG n 1 105 ALA n 1 106 GLU n 1 107 PHE n 1 108 LEU n 1 109 LYS n 1 110 GLU n 1 111 LEU n 1 112 ARG n 1 113 GLN n 1 114 VAL n 1 115 CYS n 1 116 VAL n 1 117 LYS n 1 118 GLY n 1 119 GLY n 1 120 ALA n 1 121 CYS n 1 122 GLY n 1 123 GLU n 1 124 GLY n 1 125 HIS n 1 126 HIS n 1 127 HIS n 1 128 HIS n 1 129 HIS n 1 130 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TT_C1057 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'HB27 / ATCC BAA-163 / DSM 7039' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 262724 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'modified pET26' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 TRP 5 5 5 TRP TRP A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 CYS 115 115 115 CYS CYS A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 CYS 121 121 121 CYS CYS A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 HIS 130 130 130 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LST _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LST _struct.title 'Solution structure of a thioredoxin from Thermus thermophilus' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LST _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'STRUCTURAL GENOMICS, New York Structural Genomics Research Consortium, OXIDOREDUCTASE, PSI-Biology, NYSGRC' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q72IS5_THET2 _struct_ref.pdbx_db_accession Q72IS5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RWYPYPEALALAQAHGRMVMVYFHSEHCPYCQQMNTFVLSDPGVSRLLEARFVVASVSVDTPEGQELARRYRVPGTPTFV FLVPKAGAWEEVGRLFGSRPRAEFLKELRQVCVKGGACG ; _struct_ref.pdbx_align_begin 35 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LST _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 122 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q72IS5 _struct_ref_seq.db_align_beg 35 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 153 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 122 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LST MET A 1 ? UNP Q72IS5 ? ? 'expression tag' 1 1 1 2LST SER A 2 ? UNP Q72IS5 ? ? 'expression tag' 2 2 1 2LST LEU A 3 ? UNP Q72IS5 ? ? 'expression tag' 3 3 1 2LST GLU A 123 ? UNP Q72IS5 ? ? 'expression tag' 123 4 1 2LST GLY A 124 ? UNP Q72IS5 ? ? 'expression tag' 124 5 1 2LST HIS A 125 ? UNP Q72IS5 ? ? 'expression tag' 125 6 1 2LST HIS A 126 ? UNP Q72IS5 ? ? 'expression tag' 126 7 1 2LST HIS A 127 ? UNP Q72IS5 ? ? 'expression tag' 127 8 1 2LST HIS A 128 ? UNP Q72IS5 ? ? 'expression tag' 128 9 1 2LST HIS A 129 ? UNP Q72IS5 ? ? 'expression tag' 129 10 1 2LST HIS A 130 ? UNP Q72IS5 ? ? 'expression tag' 130 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 7 ? GLY A 19 ? PRO A 7 GLY A 19 1 ? 13 HELX_P HELX_P2 2 TYR A 33 ? PHE A 40 ? TYR A 33 PHE A 40 1 ? 8 HELX_P HELX_P3 3 ASP A 44 ? ARG A 54 ? ASP A 44 ARG A 54 1 ? 11 HELX_P HELX_P4 4 THR A 64 ? TYR A 74 ? THR A 64 TYR A 74 1 ? 11 HELX_P HELX_P5 5 PRO A 103 ? CYS A 121 ? PRO A 103 CYS A 121 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 1 -1.92 2 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 2 -3.13 3 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 3 0.13 4 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 4 0.87 5 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 5 -0.60 6 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 6 0.05 7 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 7 -1.14 8 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 8 -5.05 9 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 9 0.57 10 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 10 -1.82 11 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 11 0.45 12 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 12 -0.19 13 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 13 1.42 14 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 14 -3.36 15 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 15 -4.87 16 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 16 0.05 17 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 17 4.73 18 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 18 4.06 19 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 19 1.57 20 THR 79 A . ? THR 79 A PRO 80 A ? PRO 80 A 20 0.51 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 5 ? TYR A 6 ? TRP A 5 TYR A 6 A 2 PHE A 55 ? SER A 61 ? PHE A 55 SER A 61 A 3 MET A 21 ? HIS A 27 ? MET A 21 HIS A 27 A 4 THR A 81 ? LYS A 88 ? THR A 81 LYS A 88 A 5 ALA A 91 ? PHE A 99 ? ALA A 91 PHE A 99 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 6 ? N TYR A 6 O VAL A 57 ? O VAL A 57 A 2 3 O ALA A 58 ? O ALA A 58 N MET A 23 ? N MET A 23 A 3 4 N VAL A 24 ? N VAL A 24 O VAL A 83 ? O VAL A 83 A 4 5 N PHE A 82 ? N PHE A 82 O LEU A 98 ? O LEU A 98 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 69 ? ? HH21 A ARG 72 ? ? 1.55 2 1 HD1 A HIS 30 ? ? OD2 A ASP 63 ? ? 1.57 3 2 HG A SER 28 ? ? OD2 A ASP 63 ? ? 1.57 4 2 OE1 A GLU 106 ? ? HZ2 A LYS 109 ? ? 1.58 5 2 HG1 A THR 64 ? ? OE2 A GLU 66 ? ? 1.58 6 3 HZ1 A LYS 88 ? ? OE1 A GLU 93 ? ? 1.54 7 3 HG1 A THR 64 ? ? OE2 A GLU 66 ? ? 1.59 8 4 H2 A MET 1 ? ? OE1 A GLU 52 ? ? 1.54 9 4 HZ3 A LYS 88 ? ? OE1 A GLU 93 ? ? 1.57 10 5 OE1 A GLU 106 ? ? HZ1 A LYS 109 ? ? 1.53 11 5 OH A TYR 25 ? ? HG A CYS 34 ? ? 1.60 12 5 HH12 A ARG 73 ? ? OE1 A GLU 94 ? ? 1.60 13 6 H1 A MET 1 ? ? OE2 A GLU 52 ? ? 1.57 14 6 HD1 A HIS 30 ? ? OD1 A ASP 63 ? ? 1.57 15 6 OE2 A GLU 123 ? ? HE2 A HIS 125 ? ? 1.58 16 7 OE2 A GLU 106 ? ? HZ2 A LYS 109 ? ? 1.58 17 8 OE1 A GLU 69 ? ? HH21 A ARG 73 ? ? 1.57 18 8 OE1 A GLU 106 ? ? HZ3 A LYS 109 ? ? 1.59 19 8 OE1 A GLU 123 ? ? HE2 A HIS 126 ? ? 1.59 20 9 HG1 A THR 64 ? ? OE2 A GLU 66 ? ? 1.58 21 9 H2 A MET 1 ? ? OE2 A GLU 52 ? ? 1.58 22 10 HB2 A PHE 26 ? ? HB A THR 81 ? ? 1.33 23 12 HG3 A GLU 123 ? ? H A GLY 124 ? ? 1.34 24 12 HZ3 A LYS 88 ? ? OE2 A GLU 93 ? ? 1.57 25 12 O A GLY 78 ? ? HG1 A THR 79 ? ? 1.59 26 13 HZ2 A LYS 88 ? ? OE1 A GLU 93 ? ? 1.52 27 13 HH21 A ARG 102 ? ? OE2 A GLU 106 ? ? 1.57 28 13 OE1 A GLU 106 ? ? HZ1 A LYS 109 ? ? 1.57 29 13 OE1 A GLU 123 ? ? HE2 A HIS 127 ? ? 1.59 30 13 OH A TYR 25 ? ? HG A CYS 34 ? ? 1.59 31 13 O A SER 48 ? ? H A GLU 52 ? ? 1.59 32 14 HB2 A PHE 26 ? ? HB A THR 81 ? ? 1.34 33 14 H2 A MET 1 ? ? OE1 A GLU 52 ? ? 1.59 34 14 HG1 A THR 64 ? ? OE2 A GLU 66 ? ? 1.60 35 15 OE2 A GLU 93 ? ? HE2 A HIS 125 ? ? 1.58 36 16 OE2 A GLU 69 ? ? HH12 A ARG 73 ? ? 1.58 37 16 HG1 A THR 64 ? ? OE2 A GLU 66 ? ? 1.58 38 16 HZ1 A LYS 88 ? ? OE1 A GLU 93 ? ? 1.60 39 17 HZ1 A LYS 88 ? ? OE1 A GLU 93 ? ? 1.55 40 17 HG1 A THR 64 ? ? OE2 A GLU 66 ? ? 1.60 41 17 OE2 A GLU 69 ? ? HH21 A ARG 72 ? ? 1.60 42 18 HA A LEU 50 ? ? HH21 A ARG 54 ? ? 1.34 43 19 H3 A MET 1 ? ? OE2 A GLU 52 ? ? 1.55 44 19 OE2 A GLU 106 ? ? HZ2 A LYS 109 ? ? 1.57 45 19 O A ARG 112 ? ? HG A CYS 115 ? ? 1.59 46 20 HG A CYS 121 ? ? OE2 A GLU 123 ? ? 1.56 47 20 HZ1 A LYS 109 ? ? OE1 A GLU 110 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -87.27 -75.16 2 1 PHE A 40 ? ? -91.78 -69.39 3 1 ARG A 75 ? ? 62.28 87.21 4 1 PRO A 77 ? ? -74.29 -138.65 5 1 ALA A 89 ? ? 66.46 -77.59 6 1 SER A 101 ? ? 69.64 -73.29 7 1 ARG A 102 ? ? 68.14 156.69 8 2 SER A 2 ? ? -145.48 41.96 9 2 PRO A 32 ? ? -83.70 -90.41 10 2 PHE A 40 ? ? -92.30 -68.34 11 2 ARG A 75 ? ? 63.08 79.10 12 2 PRO A 77 ? ? -65.56 -90.10 13 2 ALA A 89 ? ? 67.48 -76.13 14 2 SER A 101 ? ? 179.95 -95.48 15 2 ARG A 102 ? ? 66.65 119.13 16 2 CYS A 121 ? ? -143.88 -55.72 17 2 HIS A 126 ? ? -163.34 66.90 18 3 PRO A 32 ? ? -81.11 -92.01 19 3 PHE A 40 ? ? -90.32 -70.60 20 3 PRO A 77 ? ? -61.56 -83.52 21 3 THR A 79 ? ? 175.57 158.09 22 3 ALA A 89 ? ? 68.01 -76.80 23 3 ALA A 120 ? ? -96.27 37.36 24 3 GLU A 123 ? ? -123.81 -167.85 25 3 HIS A 128 ? ? -130.89 -41.91 26 4 SER A 2 ? ? -155.22 62.69 27 4 PHE A 40 ? ? -91.01 -70.64 28 4 ASP A 63 ? ? -163.21 -33.32 29 4 ARG A 75 ? ? 44.85 73.19 30 4 THR A 79 ? ? 71.62 138.94 31 4 ALA A 89 ? ? 68.72 -71.55 32 4 GLU A 94 ? ? -69.78 98.93 33 4 SER A 101 ? ? 68.15 174.31 34 4 GLU A 123 ? ? 68.87 -62.87 35 4 HIS A 127 ? ? -152.82 79.65 36 4 HIS A 128 ? ? 72.28 -30.25 37 5 SER A 2 ? ? 68.73 117.34 38 5 HIS A 30 ? ? -94.42 48.72 39 5 PRO A 32 ? ? -58.93 -98.56 40 5 THR A 39 ? ? -92.13 -61.58 41 5 PHE A 40 ? ? -91.45 -70.58 42 5 ALA A 89 ? ? 70.66 -65.49 43 5 SER A 101 ? ? 71.44 128.61 44 5 HIS A 126 ? ? -178.29 -30.90 45 6 PRO A 32 ? ? -84.25 -105.34 46 6 PHE A 40 ? ? -91.34 -70.32 47 6 ARG A 75 ? ? 53.81 76.85 48 6 ALA A 89 ? ? -53.59 93.42 49 6 ALA A 91 ? ? -176.95 -168.36 50 6 ALA A 120 ? ? -157.49 -55.99 51 6 CYS A 121 ? ? 73.92 -56.41 52 6 HIS A 127 ? ? 60.79 -92.03 53 6 HIS A 128 ? ? 174.44 -173.57 54 7 SER A 2 ? ? -155.54 -33.54 55 7 PRO A 32 ? ? -78.15 23.42 56 7 PHE A 40 ? ? -90.81 -70.13 57 7 PRO A 77 ? ? -73.97 -143.17 58 7 THR A 79 ? ? 176.70 158.42 59 7 ALA A 89 ? ? 65.75 -80.53 60 7 GLU A 123 ? ? 71.66 -34.51 61 7 HIS A 125 ? ? -159.83 27.53 62 8 PHE A 40 ? ? -90.45 -67.72 63 8 PRO A 77 ? ? -66.35 -150.33 64 8 ALA A 89 ? ? 67.02 -82.06 65 8 ALA A 120 ? ? -150.90 -31.96 66 8 CYS A 121 ? ? 71.49 -63.10 67 8 HIS A 126 ? ? -84.01 30.46 68 9 PRO A 32 ? ? -79.62 -78.48 69 9 PHE A 40 ? ? -90.13 -64.65 70 9 THR A 79 ? ? 75.07 137.21 71 9 ALA A 89 ? ? 67.18 -77.39 72 9 SER A 101 ? ? 75.67 -12.09 73 9 GLU A 123 ? ? -69.46 -72.82 74 10 PRO A 32 ? ? -85.83 31.98 75 10 PHE A 40 ? ? -90.87 -70.91 76 10 ARG A 75 ? ? 65.05 78.08 77 10 PRO A 77 ? ? -73.49 -143.05 78 10 THR A 79 ? ? 179.89 160.38 79 10 ALA A 89 ? ? 67.14 -75.67 80 10 ALA A 120 ? ? -151.14 -79.39 81 10 CYS A 121 ? ? 157.55 -43.12 82 11 HIS A 30 ? ? -114.07 -80.12 83 11 CYS A 31 ? ? 60.42 152.47 84 11 PRO A 32 ? ? -91.22 -89.05 85 11 PHE A 40 ? ? -91.89 -70.54 86 11 ASP A 63 ? ? -158.14 -38.70 87 11 ARG A 75 ? ? 64.74 91.16 88 11 THR A 79 ? ? 72.26 138.58 89 11 ALA A 120 ? ? -165.92 83.50 90 11 HIS A 126 ? ? 71.80 170.09 91 12 PRO A 32 ? ? -81.39 38.49 92 12 PHE A 40 ? ? -91.23 -70.19 93 12 ARG A 75 ? ? 65.04 79.64 94 12 THR A 79 ? ? 60.38 161.19 95 12 ALA A 89 ? ? 64.15 -80.14 96 12 GLU A 123 ? ? -89.38 -139.68 97 12 HIS A 128 ? ? -169.29 -169.28 98 13 SER A 2 ? ? 65.88 -163.25 99 13 PRO A 32 ? ? -76.91 -86.20 100 13 PHE A 40 ? ? -91.38 -70.60 101 13 ARG A 75 ? ? 66.20 73.10 102 13 THR A 79 ? ? 73.23 141.97 103 13 ALA A 120 ? ? -102.98 65.89 104 13 GLU A 123 ? ? -43.54 104.74 105 14 SER A 2 ? ? 68.78 -171.35 106 14 PHE A 40 ? ? -91.05 -68.40 107 14 PRO A 77 ? ? -69.63 -116.96 108 14 CYS A 121 ? ? -79.64 48.07 109 15 CYS A 31 ? ? 41.19 78.45 110 15 PHE A 40 ? ? -91.27 -71.78 111 15 THR A 79 ? ? -144.86 48.26 112 15 ALA A 89 ? ? 70.06 -76.28 113 15 ALA A 120 ? ? -140.82 -83.89 114 15 GLU A 123 ? ? -137.33 -51.09 115 15 HIS A 128 ? ? 61.31 -89.74 116 15 HIS A 129 ? ? -157.41 -30.61 117 16 PHE A 40 ? ? -90.65 -69.46 118 16 ARG A 75 ? ? 64.06 72.19 119 16 PRO A 77 ? ? -73.62 -138.76 120 16 THR A 79 ? ? 178.44 156.09 121 16 ALA A 89 ? ? 64.12 -79.80 122 16 GLU A 123 ? ? 56.30 -93.96 123 17 HIS A 30 ? ? -101.87 42.74 124 17 PHE A 40 ? ? -91.48 -67.74 125 17 PRO A 77 ? ? -80.32 -83.58 126 17 THR A 79 ? ? -146.56 -61.04 127 17 HIS A 125 ? ? 69.53 -57.01 128 17 HIS A 126 ? ? -144.13 19.23 129 18 SER A 2 ? ? -144.48 -51.50 130 18 PRO A 32 ? ? -56.19 -81.21 131 18 PHE A 40 ? ? -90.97 -69.84 132 18 ASP A 63 ? ? -163.67 -36.41 133 18 ARG A 75 ? ? 45.95 71.19 134 18 THR A 79 ? ? -47.03 152.36 135 18 ALA A 89 ? ? 71.14 -37.61 136 18 ALA A 120 ? ? 69.81 144.72 137 18 CYS A 121 ? ? -171.00 -52.12 138 19 PHE A 40 ? ? -92.88 -68.52 139 19 ALA A 89 ? ? 70.19 -72.13 140 19 ALA A 120 ? ? -155.18 -72.68 141 19 CYS A 121 ? ? 64.00 -87.87 142 19 GLU A 123 ? ? -96.04 41.93 143 19 HIS A 125 ? ? -122.42 -64.01 144 19 HIS A 126 ? ? 57.01 -150.60 145 19 HIS A 127 ? ? -155.84 -25.46 146 19 HIS A 128 ? ? -77.77 35.58 147 20 PHE A 40 ? ? -89.86 -71.26 148 20 ARG A 75 ? ? 55.71 81.22 149 20 ALA A 89 ? ? 67.06 -75.72 150 20 CYS A 121 ? ? 68.98 -57.59 151 20 HIS A 125 ? ? -172.39 23.22 # _pdbx_SG_project.full_name_of_center 'New York Structural Genomics Research Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NYSGRC _pdbx_SG_project.project_name PSI:Biology # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria '20 structures for lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LST _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LST _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5 mM [U-13C; U-15N] thioredoxin, 20 mM sodium phosphate, 50 mM sodium chloride, 5 mM DTT, 1 mM EDTA, 90% H2O, 10% D2O' 1 '90% H2O/10% D2O' '0.5 mM [U-13C; U-15N] thioredoxin, 20 mM sodium phosphate, 50 mM sodium chloride, 5 mM DTT, 1 mM EDTA, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id thioredoxin-1 0.5 ? mM '[U-13C; U-15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 50 ? mM ? 1 DTT-4 5 ? mM ? 1 EDTA-5 1 ? mM ? 1 thioredoxin-6 0.5 ? mM '[U-13C; U-15N]' 2 'sodium phosphate-7' 20 ? mM ? 2 'sodium chloride-8' 50 ? mM ? 2 DTT-9 5 ? mM ? 2 EDTA-10 1 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 70 _pdbx_nmr_exptl_sample_conditions.pH 5.8 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '15N HSQC' 1 2 1 '15N NOESY-HSQC' 1 3 2 '13C HSQC' 1 4 2 'aromatic 13C HSQC' 1 5 2 '13C NOESY-HSQC' 1 6 2 '13C aromatic NOESY-HSQC' 1 7 1 HNCO 1 8 1 HNCACO 1 9 1 HNCA 1 10 1 HNCOCA 1 11 1 HNCACB 1 12 1 CBCACONH # _pdbx_nmr_details.entry_id 2LST _pdbx_nmr_details.text 'All 3Ds collected using Non-Uniform Sampling with the MDDNMR and MDDGUI programs' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LST _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 47 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2100 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 553 _pdbx_nmr_constraints.NOE_long_range_total_count 598 _pdbx_nmr_constraints.NOE_medium_range_total_count 405 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 494 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 31 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 93 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 93 # _pdbx_nmr_refine.entry_id 2LST _pdbx_nmr_refine.method 'simulating annealing' _pdbx_nmr_refine.details 'Refinement in a box of water' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.21 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.21 2 ;Linge, O'Donoghue and Nilges ; 'data analysis' ARIA 2.3 3 CCPN 'data analysis' CCPN 2.1.5 4 CCPN 'peak picking' CCPN 2.1.5 5 CCPN 'chemical shift assignment' CCPN 2.1.5 6 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 5.4 7 Varian collection VnmrJ 2.2D 8 'Bruker Biospin' collection TopSpin 1.3 9 '(MDDNMR) Orekhov, Jaravine, Kazimierczuk' collection MddNMR 2.0 10 '(MDDNMR) Orekhov, Jaravine, Kazimierczuk' processing MddNMR 2.0 11 '(MDDGUI) Lemak, Gutmanas, Chitayat, Karra, Fares, Sunnerhagen, Arrowsmith' collection MDDGUI 1.0 12 '(MDDGUI) Lemak, Gutmanas, Chitayat, Karra, Fares, Sunnerhagen, Arrowsmith' processing MDDGUI 1.0 13 Hansen 'data analysis' SideR ? 14 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 LEU N N N N 158 LEU CA C N S 159 LEU C C N N 160 LEU O O N N 161 LEU CB C N N 162 LEU CG C N N 163 LEU CD1 C N N 164 LEU CD2 C N N 165 LEU OXT O N N 166 LEU H H N N 167 LEU H2 H N N 168 LEU HA H N N 169 LEU HB2 H N N 170 LEU HB3 H N N 171 LEU HG H N N 172 LEU HD11 H N N 173 LEU HD12 H N N 174 LEU HD13 H N N 175 LEU HD21 H N N 176 LEU HD22 H N N 177 LEU HD23 H N N 178 LEU HXT H N N 179 LYS N N N N 180 LYS CA C N S 181 LYS C C N N 182 LYS O O N N 183 LYS CB C N N 184 LYS CG C N N 185 LYS CD C N N 186 LYS CE C N N 187 LYS NZ N N N 188 LYS OXT O N N 189 LYS H H N N 190 LYS H2 H N N 191 LYS HA H N N 192 LYS HB2 H N N 193 LYS HB3 H N N 194 LYS HG2 H N N 195 LYS HG3 H N N 196 LYS HD2 H N N 197 LYS HD3 H N N 198 LYS HE2 H N N 199 LYS HE3 H N N 200 LYS HZ1 H N N 201 LYS HZ2 H N N 202 LYS HZ3 H N N 203 LYS HXT H N N 204 MET N N N N 205 MET CA C N S 206 MET C C N N 207 MET O O N N 208 MET CB C N N 209 MET CG C N N 210 MET SD S N N 211 MET CE C N N 212 MET OXT O N N 213 MET H H N N 214 MET H2 H N N 215 MET HA H N N 216 MET HB2 H N N 217 MET HB3 H N N 218 MET HG2 H N N 219 MET HG3 H N N 220 MET HE1 H N N 221 MET HE2 H N N 222 MET HE3 H N N 223 MET HXT H N N 224 PHE N N N N 225 PHE CA C N S 226 PHE C C N N 227 PHE O O N N 228 PHE CB C N N 229 PHE CG C Y N 230 PHE CD1 C Y N 231 PHE CD2 C Y N 232 PHE CE1 C Y N 233 PHE CE2 C Y N 234 PHE CZ C Y N 235 PHE OXT O N N 236 PHE H H N N 237 PHE H2 H N N 238 PHE HA H N N 239 PHE HB2 H N N 240 PHE HB3 H N N 241 PHE HD1 H N N 242 PHE HD2 H N N 243 PHE HE1 H N N 244 PHE HE2 H N N 245 PHE HZ H N N 246 PHE HXT H N N 247 PRO N N N N 248 PRO CA C N S 249 PRO C C N N 250 PRO O O N N 251 PRO CB C N N 252 PRO CG C N N 253 PRO CD C N N 254 PRO OXT O N N 255 PRO H H N N 256 PRO HA H N N 257 PRO HB2 H N N 258 PRO HB3 H N N 259 PRO HG2 H N N 260 PRO HG3 H N N 261 PRO HD2 H N N 262 PRO HD3 H N N 263 PRO HXT H N N 264 SER N N N N 265 SER CA C N S 266 SER C C N N 267 SER O O N N 268 SER CB C N N 269 SER OG O N N 270 SER OXT O N N 271 SER H H N N 272 SER H2 H N N 273 SER HA H N N 274 SER HB2 H N N 275 SER HB3 H N N 276 SER HG H N N 277 SER HXT H N N 278 THR N N N N 279 THR CA C N S 280 THR C C N N 281 THR O O N N 282 THR CB C N R 283 THR OG1 O N N 284 THR CG2 C N N 285 THR OXT O N N 286 THR H H N N 287 THR H2 H N N 288 THR HA H N N 289 THR HB H N N 290 THR HG1 H N N 291 THR HG21 H N N 292 THR HG22 H N N 293 THR HG23 H N N 294 THR HXT H N N 295 TRP N N N N 296 TRP CA C N S 297 TRP C C N N 298 TRP O O N N 299 TRP CB C N N 300 TRP CG C Y N 301 TRP CD1 C Y N 302 TRP CD2 C Y N 303 TRP NE1 N Y N 304 TRP CE2 C Y N 305 TRP CE3 C Y N 306 TRP CZ2 C Y N 307 TRP CZ3 C Y N 308 TRP CH2 C Y N 309 TRP OXT O N N 310 TRP H H N N 311 TRP H2 H N N 312 TRP HA H N N 313 TRP HB2 H N N 314 TRP HB3 H N N 315 TRP HD1 H N N 316 TRP HE1 H N N 317 TRP HE3 H N N 318 TRP HZ2 H N N 319 TRP HZ3 H N N 320 TRP HH2 H N N 321 TRP HXT H N N 322 TYR N N N N 323 TYR CA C N S 324 TYR C C N N 325 TYR O O N N 326 TYR CB C N N 327 TYR CG C Y N 328 TYR CD1 C Y N 329 TYR CD2 C Y N 330 TYR CE1 C Y N 331 TYR CE2 C Y N 332 TYR CZ C Y N 333 TYR OH O N N 334 TYR OXT O N N 335 TYR H H N N 336 TYR H2 H N N 337 TYR HA H N N 338 TYR HB2 H N N 339 TYR HB3 H N N 340 TYR HD1 H N N 341 TYR HD2 H N N 342 TYR HE1 H N N 343 TYR HE2 H N N 344 TYR HH H N N 345 TYR HXT H N N 346 VAL N N N N 347 VAL CA C N S 348 VAL C C N N 349 VAL O O N N 350 VAL CB C N N 351 VAL CG1 C N N 352 VAL CG2 C N N 353 VAL OXT O N N 354 VAL H H N N 355 VAL H2 H N N 356 VAL HA H N N 357 VAL HB H N N 358 VAL HG11 H N N 359 VAL HG12 H N N 360 VAL HG13 H N N 361 VAL HG21 H N N 362 VAL HG22 H N N 363 VAL HG23 H N N 364 VAL HXT H N N 365 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TRP N CA sing N N 283 TRP N H sing N N 284 TRP N H2 sing N N 285 TRP CA C sing N N 286 TRP CA CB sing N N 287 TRP CA HA sing N N 288 TRP C O doub N N 289 TRP C OXT sing N N 290 TRP CB CG sing N N 291 TRP CB HB2 sing N N 292 TRP CB HB3 sing N N 293 TRP CG CD1 doub Y N 294 TRP CG CD2 sing Y N 295 TRP CD1 NE1 sing Y N 296 TRP CD1 HD1 sing N N 297 TRP CD2 CE2 doub Y N 298 TRP CD2 CE3 sing Y N 299 TRP NE1 CE2 sing Y N 300 TRP NE1 HE1 sing N N 301 TRP CE2 CZ2 sing Y N 302 TRP CE3 CZ3 doub Y N 303 TRP CE3 HE3 sing N N 304 TRP CZ2 CH2 doub Y N 305 TRP CZ2 HZ2 sing N N 306 TRP CZ3 CH2 sing Y N 307 TRP CZ3 HZ3 sing N N 308 TRP CH2 HH2 sing N N 309 TRP OXT HXT sing N N 310 TYR N CA sing N N 311 TYR N H sing N N 312 TYR N H2 sing N N 313 TYR CA C sing N N 314 TYR CA CB sing N N 315 TYR CA HA sing N N 316 TYR C O doub N N 317 TYR C OXT sing N N 318 TYR CB CG sing N N 319 TYR CB HB2 sing N N 320 TYR CB HB3 sing N N 321 TYR CG CD1 doub Y N 322 TYR CG CD2 sing Y N 323 TYR CD1 CE1 sing Y N 324 TYR CD1 HD1 sing N N 325 TYR CD2 CE2 doub Y N 326 TYR CD2 HD2 sing N N 327 TYR CE1 CZ doub Y N 328 TYR CE1 HE1 sing N N 329 TYR CE2 CZ sing Y N 330 TYR CE2 HE2 sing N N 331 TYR CZ OH sing N N 332 TYR OH HH sing N N 333 TYR OXT HXT sing N N 334 VAL N CA sing N N 335 VAL N H sing N N 336 VAL N H2 sing N N 337 VAL CA C sing N N 338 VAL CA CB sing N N 339 VAL CA HA sing N N 340 VAL C O doub N N 341 VAL C OXT sing N N 342 VAL CB CG1 sing N N 343 VAL CB CG2 sing N N 344 VAL CB HB sing N N 345 VAL CG1 HG11 sing N N 346 VAL CG1 HG12 sing N N 347 VAL CG1 HG13 sing N N 348 VAL CG2 HG21 sing N N 349 VAL CG2 HG22 sing N N 350 VAL CG2 HG23 sing N N 351 VAL OXT HXT sing N N 352 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian Inova' 600 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2LST _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_