data_2LSY # _entry.id 2LSY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LSY pdb_00002lsy 10.2210/pdb2lsy/pdb RCSB RCSB102794 ? ? BMRB 18455 ? ? WWPDB D_1000102794 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2LSK PDB . unspecified 18455 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LSY _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-05-09 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pozhidaeva, A.' 1 'Pustovalova, Y.' 2 'Bezsonova, I.' 3 'Korzhnev, D.' 4 # _citation.id primary _citation.title ;NMR structure and dynamics of the C-terminal domain from human Rev1 and its complex with Rev1 interacting region of DNA polymerase eta. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 51 _citation.page_first 5506 _citation.page_last 5520 _citation.year 2012 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22691049 _citation.pdbx_database_id_DOI 10.1021/bi300566z # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pozhidaeva, A.' 1 ? primary 'Pustovalova, Y.' 2 ? primary ;D'Souza, S. ; 3 ? primary 'Bezsonova, I.' 4 ? primary 'Walker, G.C.' 5 ? primary 'Korzhnev, D.M.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DNA repair protein REV1' _entity.formula_weight 11011.666 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-TERMINAL DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Alpha integrin-binding protein 80, AIBP80, Rev1-like terminal deoxycytidyl transferase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNV QVVLQQTYGSTLKVT ; _entity_poly.pdbx_seq_one_letter_code_can ;GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNV QVVLQQTYGSTLKVT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASN n 1 3 LEU n 1 4 ALA n 1 5 GLY n 1 6 ALA n 1 7 VAL n 1 8 GLU n 1 9 PHE n 1 10 ASN n 1 11 ASP n 1 12 VAL n 1 13 LYS n 1 14 THR n 1 15 LEU n 1 16 LEU n 1 17 ARG n 1 18 GLU n 1 19 TRP n 1 20 ILE n 1 21 THR n 1 22 THR n 1 23 ILE n 1 24 SER n 1 25 ASP n 1 26 PRO n 1 27 MET n 1 28 GLU n 1 29 GLU n 1 30 ASP n 1 31 ILE n 1 32 LEU n 1 33 GLN n 1 34 VAL n 1 35 VAL n 1 36 LYS n 1 37 TYR n 1 38 CYS n 1 39 THR n 1 40 ASP n 1 41 LEU n 1 42 ILE n 1 43 GLU n 1 44 GLU n 1 45 LYS n 1 46 ASP n 1 47 LEU n 1 48 GLU n 1 49 LYS n 1 50 LEU n 1 51 ASP n 1 52 LEU n 1 53 VAL n 1 54 ILE n 1 55 LYS n 1 56 TYR n 1 57 MET n 1 58 LYS n 1 59 ARG n 1 60 LEU n 1 61 MET n 1 62 GLN n 1 63 GLN n 1 64 SER n 1 65 VAL n 1 66 GLU n 1 67 SER n 1 68 VAL n 1 69 TRP n 1 70 ASN n 1 71 MET n 1 72 ALA n 1 73 PHE n 1 74 ASP n 1 75 PHE n 1 76 ILE n 1 77 LEU n 1 78 ASP n 1 79 ASN n 1 80 VAL n 1 81 GLN n 1 82 VAL n 1 83 VAL n 1 84 LEU n 1 85 GLN n 1 86 GLN n 1 87 THR n 1 88 TYR n 1 89 GLY n 1 90 SER n 1 91 THR n 1 92 LEU n 1 93 LYS n 1 94 VAL n 1 95 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code REV1_HUMAN _struct_ref.pdbx_db_accession Q9UBZ9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQ VVLQQTYGSTLKVT ; _struct_ref.pdbx_align_begin 1158 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LSY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 95 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UBZ9 _struct_ref_seq.db_align_beg 1158 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1251 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1158 _struct_ref_seq.pdbx_auth_seq_align_end 1251 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2LSY _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9UBZ9 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1157 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCO' 1 3 1 '3D HNCACB' 1 4 1 '3D HNCA' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '2D 1H-13C HSQC aliphatic' 1 7 1 '2D 1H-13C HSQC aromatic' 1 8 1 '3D 1H-13C NOESY aromatic' 1 9 1 '3D 1H-13C NOESY aliphatic' 1 10 1 '3D HBHA(CO)NH' 1 11 1 '3D HCCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.9 mM [U-99% 13C; U-99% 15N] REV1-CT, 50 mM sodium phosphate, 100 mM sodium chloride, 0.25 mM EDTA, 5 mM DTT, 0.05 % sodium azide, 90 % H2O, 10 % [U-2H] D2O, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Varian INOVA 1 'Varian INOVA' 800 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LSY _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LSY _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LSY _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 1 'Keller and Wuthrich' 'data analysis' CARA ? 2 'Keller and Wuthrich' 'peak picking' CARA ? 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 4 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL ? 5 Varian collection VnmrJ ? 6 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 7 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LSY _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LSY _struct.title 'Structure of the C-terminal domain from human REV1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LSY _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'DNA polymerase, translesion synthesis, DNA repair, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 8 ? ILE A 23 ? GLU A 1164 ILE A 1179 1 ? 16 HELX_P HELX_P2 2 MET A 27 ? GLU A 44 ? MET A 1183 GLU A 1200 1 ? 18 HELX_P HELX_P3 3 ASP A 46 ? SER A 64 ? ASP A 1202 SER A 1220 1 ? 19 HELX_P HELX_P4 4 SER A 67 ? TYR A 88 ? SER A 1223 TYR A 1244 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2LSY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1157 1157 GLY GLY A . n A 1 2 ASN 2 1158 1158 ASN ASN A . n A 1 3 LEU 3 1159 1159 LEU LEU A . n A 1 4 ALA 4 1160 1160 ALA ALA A . n A 1 5 GLY 5 1161 1161 GLY GLY A . n A 1 6 ALA 6 1162 1162 ALA ALA A . n A 1 7 VAL 7 1163 1163 VAL VAL A . n A 1 8 GLU 8 1164 1164 GLU GLU A . n A 1 9 PHE 9 1165 1165 PHE PHE A . n A 1 10 ASN 10 1166 1166 ASN ASN A . n A 1 11 ASP 11 1167 1167 ASP ASP A . n A 1 12 VAL 12 1168 1168 VAL VAL A . n A 1 13 LYS 13 1169 1169 LYS LYS A . n A 1 14 THR 14 1170 1170 THR THR A . n A 1 15 LEU 15 1171 1171 LEU LEU A . n A 1 16 LEU 16 1172 1172 LEU LEU A . n A 1 17 ARG 17 1173 1173 ARG ARG A . n A 1 18 GLU 18 1174 1174 GLU GLU A . n A 1 19 TRP 19 1175 1175 TRP TRP A . n A 1 20 ILE 20 1176 1176 ILE ILE A . n A 1 21 THR 21 1177 1177 THR THR A . n A 1 22 THR 22 1178 1178 THR THR A . n A 1 23 ILE 23 1179 1179 ILE ILE A . n A 1 24 SER 24 1180 1180 SER SER A . n A 1 25 ASP 25 1181 1181 ASP ASP A . n A 1 26 PRO 26 1182 1182 PRO PRO A . n A 1 27 MET 27 1183 1183 MET MET A . n A 1 28 GLU 28 1184 1184 GLU GLU A . n A 1 29 GLU 29 1185 1185 GLU GLU A . n A 1 30 ASP 30 1186 1186 ASP ASP A . n A 1 31 ILE 31 1187 1187 ILE ILE A . n A 1 32 LEU 32 1188 1188 LEU LEU A . n A 1 33 GLN 33 1189 1189 GLN GLN A . n A 1 34 VAL 34 1190 1190 VAL VAL A . n A 1 35 VAL 35 1191 1191 VAL VAL A . n A 1 36 LYS 36 1192 1192 LYS LYS A . n A 1 37 TYR 37 1193 1193 TYR TYR A . n A 1 38 CYS 38 1194 1194 CYS CYS A . n A 1 39 THR 39 1195 1195 THR THR A . n A 1 40 ASP 40 1196 1196 ASP ASP A . n A 1 41 LEU 41 1197 1197 LEU LEU A . n A 1 42 ILE 42 1198 1198 ILE ILE A . n A 1 43 GLU 43 1199 1199 GLU GLU A . n A 1 44 GLU 44 1200 1200 GLU GLU A . n A 1 45 LYS 45 1201 1201 LYS LYS A . n A 1 46 ASP 46 1202 1202 ASP ASP A . n A 1 47 LEU 47 1203 1203 LEU LEU A . n A 1 48 GLU 48 1204 1204 GLU GLU A . n A 1 49 LYS 49 1205 1205 LYS LYS A . n A 1 50 LEU 50 1206 1206 LEU LEU A . n A 1 51 ASP 51 1207 1207 ASP ASP A . n A 1 52 LEU 52 1208 1208 LEU LEU A . n A 1 53 VAL 53 1209 1209 VAL VAL A . n A 1 54 ILE 54 1210 1210 ILE ILE A . n A 1 55 LYS 55 1211 1211 LYS LYS A . n A 1 56 TYR 56 1212 1212 TYR TYR A . n A 1 57 MET 57 1213 1213 MET MET A . n A 1 58 LYS 58 1214 1214 LYS LYS A . n A 1 59 ARG 59 1215 1215 ARG ARG A . n A 1 60 LEU 60 1216 1216 LEU LEU A . n A 1 61 MET 61 1217 1217 MET MET A . n A 1 62 GLN 62 1218 1218 GLN GLN A . n A 1 63 GLN 63 1219 1219 GLN GLN A . n A 1 64 SER 64 1220 1220 SER SER A . n A 1 65 VAL 65 1221 1221 VAL VAL A . n A 1 66 GLU 66 1222 1222 GLU GLU A . n A 1 67 SER 67 1223 1223 SER SER A . n A 1 68 VAL 68 1224 1224 VAL VAL A . n A 1 69 TRP 69 1225 1225 TRP TRP A . n A 1 70 ASN 70 1226 1226 ASN ASN A . n A 1 71 MET 71 1227 1227 MET MET A . n A 1 72 ALA 72 1228 1228 ALA ALA A . n A 1 73 PHE 73 1229 1229 PHE PHE A . n A 1 74 ASP 74 1230 1230 ASP ASP A . n A 1 75 PHE 75 1231 1231 PHE PHE A . n A 1 76 ILE 76 1232 1232 ILE ILE A . n A 1 77 LEU 77 1233 1233 LEU LEU A . n A 1 78 ASP 78 1234 1234 ASP ASP A . n A 1 79 ASN 79 1235 1235 ASN ASN A . n A 1 80 VAL 80 1236 1236 VAL VAL A . n A 1 81 GLN 81 1237 1237 GLN GLN A . n A 1 82 VAL 82 1238 1238 VAL VAL A . n A 1 83 VAL 83 1239 1239 VAL VAL A . n A 1 84 LEU 84 1240 1240 LEU LEU A . n A 1 85 GLN 85 1241 1241 GLN GLN A . n A 1 86 GLN 86 1242 1242 GLN GLN A . n A 1 87 THR 87 1243 1243 THR THR A . n A 1 88 TYR 88 1244 1244 TYR TYR A . n A 1 89 GLY 89 1245 1245 GLY GLY A . n A 1 90 SER 90 1246 1246 SER SER A . n A 1 91 THR 91 1247 1247 THR THR A . n A 1 92 LEU 92 1248 1248 LEU LEU A . n A 1 93 LYS 93 1249 1249 LYS LYS A . n A 1 94 VAL 94 1250 1250 VAL VAL A . n A 1 95 THR 95 1251 1251 THR THR A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-06-27 2 'Structure model' 1 1 2013-06-19 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id REV1-CT-1 0.9 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate-2' 50 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 EDTA-4 0.25 ? mM ? 1 DTT-5 5 ? mM ? 1 'sodium azide-6' 0.05 ? % ? 1 H2O-7 90 ? % ? 1 D2O-8 10 ? % '[U-2H]' 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 VAL A 1163 ? ? -95.12 -63.13 2 4 THR A 1243 ? ? -94.06 -62.86 3 5 VAL A 1163 ? ? -92.69 -72.45 4 6 ALA A 1160 ? ? 59.32 19.69 5 6 ASP A 1181 ? ? -151.01 86.82 6 7 SER A 1180 ? ? 69.50 -66.49 7 7 VAL A 1221 ? ? -69.70 78.28 8 8 VAL A 1250 ? ? 41.00 100.91 9 9 VAL A 1163 ? ? -125.93 -53.71 10 9 THR A 1243 ? ? -95.74 -62.84 11 9 VAL A 1250 ? ? 50.07 93.34 12 10 ASN A 1158 ? ? 64.49 116.11 13 11 VAL A 1250 ? ? -59.87 104.20 14 12 TRP A 1175 ? ? -72.54 -71.22 15 12 VAL A 1250 ? ? -69.28 99.01 16 13 VAL A 1163 ? ? -102.78 -68.44 17 15 VAL A 1163 ? ? -125.47 -61.03 18 15 VAL A 1250 ? ? -43.17 99.03 19 16 VAL A 1250 ? ? 65.07 103.00 20 17 VAL A 1163 ? ? -128.26 -71.36 21 18 THR A 1243 ? ? -91.39 -61.36 22 18 LYS A 1249 ? ? -80.32 35.01 23 19 VAL A 1250 ? ? -86.55 33.22 24 20 VAL A 1221 ? ? 46.91 21.75 25 20 THR A 1243 ? ? -90.57 -61.26 26 20 LYS A 1249 ? ? -74.78 40.95 #