data_2LTD # _entry.id 2LTD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LTD RCSB RCSB102809 BMRB 18469 WWPDB D_1000102809 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18469 BMRB unspecified . NESG-KR150 TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LTD _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-05-16 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rossi, P.' 1 'Barbieri, C.M.' 2 'Aramini, J.M.' 3 'Bini, E.' 4 'Lee, H.' 5 'Janjua, H.' 6 'Ciccosanti, C.' 7 'Wang, H.' 8 'Acton, T.B.' 9 'Xiao, R.' 10 'Everett, J.K.' 11 'Montelione, G.T.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title ;Structures of apo- and ssDNA-bound YdbC from Lactococcus lactis uncover the function of protein domain family DUF2128 and expand the single-stranded DNA-binding domain proteome. ; _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 41 _citation.page_first 2756 _citation.page_last 2768 _citation.year 2013 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23303792 _citation.pdbx_database_id_DOI 10.1093/nar/gks1348 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Rossi, P.' 1 primary 'Barbieri, C.M.' 2 primary 'Aramini, J.M.' 3 primary 'Bini, E.' 4 primary 'Lee, H.W.' 5 primary 'Janjua, H.' 6 primary 'Xiao, R.' 7 primary 'Acton, T.B.' 8 primary 'Montelione, G.T.' 9 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein ydbC' _entity.formula_weight 9488.755 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MADKLKFEIIEELIVLSENAKGWRKELNRVSWNDAEPKYDIRTWSPDHEKMGKGITLSEEEFGVLLKELGNKLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MADKLKFEIIEELIVLSENAKGWRKELNRVSWNDAEPKYDIRTWSPDHEKMGKGITLSEEEFGVLLKELGNKLEHHHHHH _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier NESG-KR150 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ASP n 1 4 LYS n 1 5 LEU n 1 6 LYS n 1 7 PHE n 1 8 GLU n 1 9 ILE n 1 10 ILE n 1 11 GLU n 1 12 GLU n 1 13 LEU n 1 14 ILE n 1 15 VAL n 1 16 LEU n 1 17 SER n 1 18 GLU n 1 19 ASN n 1 20 ALA n 1 21 LYS n 1 22 GLY n 1 23 TRP n 1 24 ARG n 1 25 LYS n 1 26 GLU n 1 27 LEU n 1 28 ASN n 1 29 ARG n 1 30 VAL n 1 31 SER n 1 32 TRP n 1 33 ASN n 1 34 ASP n 1 35 ALA n 1 36 GLU n 1 37 PRO n 1 38 LYS n 1 39 TYR n 1 40 ASP n 1 41 ILE n 1 42 ARG n 1 43 THR n 1 44 TRP n 1 45 SER n 1 46 PRO n 1 47 ASP n 1 48 HIS n 1 49 GLU n 1 50 LYS n 1 51 MET n 1 52 GLY n 1 53 LYS n 1 54 GLY n 1 55 ILE n 1 56 THR n 1 57 LEU n 1 58 SER n 1 59 GLU n 1 60 GLU n 1 61 GLU n 1 62 PHE n 1 63 GLY n 1 64 VAL n 1 65 LEU n 1 66 LEU n 1 67 LYS n 1 68 GLU n 1 69 LEU n 1 70 GLY n 1 71 ASN n 1 72 LYS n 1 73 LEU n 1 74 GLU n 1 75 HIS n 1 76 HIS n 1 77 HIS n 1 78 HIS n 1 79 HIS n 1 80 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'L114363, LL0313, ydbC' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain IL1403 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactococcus lactis subsp. lactis Il1403' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272623 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET21_NESG _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9CIP3_LACLA _struct_ref.pdbx_db_accession Q9CIP3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MADKLKFEIIEELIVLSENAKGWRKELNRVSWNDAEPKYDIRTWSPDHEKMGKGITLSEEEFGVLLKELGNK _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LTD A 1 ? 72 ? Q9CIP3 1 ? 72 ? 1 72 2 1 2LTD B 1 ? 72 ? Q9CIP3 1 ? 72 ? 1 72 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LTD LEU A 73 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 73 1 1 2LTD GLU A 74 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 74 2 1 2LTD HIS A 75 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 75 3 1 2LTD HIS A 76 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 76 4 1 2LTD HIS A 77 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 77 5 1 2LTD HIS A 78 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 78 6 1 2LTD HIS A 79 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 79 7 1 2LTD HIS A 80 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 80 8 2 2LTD LEU B 73 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 73 9 2 2LTD GLU B 74 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 74 10 2 2LTD HIS B 75 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 75 11 2 2LTD HIS B 76 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 76 12 2 2LTD HIS B 77 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 77 13 2 2LTD HIS B 78 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 78 14 2 2LTD HIS B 79 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 79 15 2 2LTD HIS B 80 ? UNP Q9CIP3 ? ? 'EXPRESSION TAG' 80 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 1 '3D 1H-13C NOESY aliphatic' 1 8 1 '3D 1H-13C NOESY aromatic' 1 9 1 '3D 1H-15N NOESY' 1 10 3 3D-X-filt-13C-editedNOESY 1 11 1 '3D HCCH-TOCSY' 1 12 1 '3D HBHA(CO)NH' 1 13 1 '3D HN(CA)CO' 1 14 1 '3D HCCH-COSY' 1 15 1 '3D CCH-TOCSY' 1 16 2 '1H-15N Hetnoe' 1 17 1 '1D T1' 1 18 1 '1D T2(cpmg)' 1 19 2 'j-mod HSQC (rdc)' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1.1 mM [U-100% 13C; U-100% 15N] KR150.020, 0.02 % NaN3, 10 mM DTT, 100 mM NaCL, 10 % D2O, 50 uM DSS, 10 mM TRIS-HCl, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.697 mM [U-5% 13C; U-100% 15N] KR150.020, 0.02 % NaN3, 10 mM DTT, 100 mM NaCL, 10 % D2O, 50 uM DSS, 10 mM TRIS-HCl, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' '1.2 mM KR150.019, 0.02 % NaN3, 10 mM DTT, 100 mM NaCL, 10 % D2O, 50 uM DSS, 10 mM TRIS-HCl, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker Avance 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LTD _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details 'RESTRAINED MD IN WATER BATH, PARAM19, NCS SYMMETRY' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LTD _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LTD _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 7 'Bruker Biospin' collection TOPSPIN ? 8 Varian collection VNMRJ ? 9 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE ? 10 Goddard 'data analysis' SPARKY ? 11 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 12 'PALES (Zweckstetter, Bax)' 'geometry optimization' PALES ? 13 'Bhattacharya, Montelione' 'structure validation' PSVS ? 14 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LTD _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LTD _struct.title 'Solution NMR Structure of apo YdbC from Lactococcus lactis, Northeast Structural Genomics Consortium (NESG) Target KR150' _struct.pdbx_descriptor 'Uncharacterized protein ydbC' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LTD _struct_keywords.pdbx_keywords 'Structural Genomics, Unknown Function' _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, PSI-Biology, Protein Structure Initiative, Unknown Function' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 58 ? LEU A 73 ? SER A 58 LEU A 73 1 ? 16 HELX_P HELX_P2 2 SER B 58 ? LEU B 73 ? SER B 58 LEU B 73 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 7 ? ASN A 19 ? PHE A 7 ASN A 19 A 2 GLY A 22 ? TRP A 32 ? GLY A 22 TRP A 32 A 3 PRO A 37 ? TRP A 44 ? PRO A 37 TRP A 44 A 4 MET A 51 ? LEU A 57 ? MET A 51 LEU A 57 B 1 PHE B 7 ? SER B 17 ? PHE B 7 SER B 17 B 2 ARG B 24 ? TRP B 32 ? ARG B 24 TRP B 32 B 3 PRO B 37 ? TRP B 44 ? PRO B 37 TRP B 44 B 4 MET B 51 ? LEU B 57 ? MET B 51 LEU B 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 8 ? N GLU A 8 O SER A 31 ? O SER A 31 A 2 3 N ARG A 24 ? N ARG A 24 O TRP A 44 ? O TRP A 44 A 3 4 N TYR A 39 ? N TYR A 39 O LEU A 57 ? O LEU A 57 B 1 2 N ILE B 14 ? N ILE B 14 O LEU B 27 ? O LEU B 27 B 2 3 N ASN B 28 ? N ASN B 28 O ASP B 40 ? O ASP B 40 B 3 4 N TYR B 39 ? N TYR B 39 O LEU B 57 ? O LEU B 57 # _atom_sites.entry_id 2LTD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 HIS 80 80 80 HIS HIS A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 ALA 2 2 2 ALA ALA B . n B 1 3 ASP 3 3 3 ASP ASP B . n B 1 4 LYS 4 4 4 LYS LYS B . n B 1 5 LEU 5 5 5 LEU LEU B . n B 1 6 LYS 6 6 6 LYS LYS B . n B 1 7 PHE 7 7 7 PHE PHE B . n B 1 8 GLU 8 8 8 GLU GLU B . n B 1 9 ILE 9 9 9 ILE ILE B . n B 1 10 ILE 10 10 10 ILE ILE B . n B 1 11 GLU 11 11 11 GLU GLU B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 ILE 14 14 14 ILE ILE B . n B 1 15 VAL 15 15 15 VAL VAL B . n B 1 16 LEU 16 16 16 LEU LEU B . n B 1 17 SER 17 17 17 SER SER B . n B 1 18 GLU 18 18 18 GLU GLU B . n B 1 19 ASN 19 19 19 ASN ASN B . n B 1 20 ALA 20 20 20 ALA ALA B . n B 1 21 LYS 21 21 21 LYS LYS B . n B 1 22 GLY 22 22 22 GLY GLY B . n B 1 23 TRP 23 23 23 TRP TRP B . n B 1 24 ARG 24 24 24 ARG ARG B . n B 1 25 LYS 25 25 25 LYS LYS B . n B 1 26 GLU 26 26 26 GLU GLU B . n B 1 27 LEU 27 27 27 LEU LEU B . n B 1 28 ASN 28 28 28 ASN ASN B . n B 1 29 ARG 29 29 29 ARG ARG B . n B 1 30 VAL 30 30 30 VAL VAL B . n B 1 31 SER 31 31 31 SER SER B . n B 1 32 TRP 32 32 32 TRP TRP B . n B 1 33 ASN 33 33 33 ASN ASN B . n B 1 34 ASP 34 34 34 ASP ASP B . n B 1 35 ALA 35 35 35 ALA ALA B . n B 1 36 GLU 36 36 36 GLU GLU B . n B 1 37 PRO 37 37 37 PRO PRO B . n B 1 38 LYS 38 38 38 LYS LYS B . n B 1 39 TYR 39 39 39 TYR TYR B . n B 1 40 ASP 40 40 40 ASP ASP B . n B 1 41 ILE 41 41 41 ILE ILE B . n B 1 42 ARG 42 42 42 ARG ARG B . n B 1 43 THR 43 43 43 THR THR B . n B 1 44 TRP 44 44 44 TRP TRP B . n B 1 45 SER 45 45 45 SER SER B . n B 1 46 PRO 46 46 46 PRO PRO B . n B 1 47 ASP 47 47 47 ASP ASP B . n B 1 48 HIS 48 48 48 HIS HIS B . n B 1 49 GLU 49 49 49 GLU GLU B . n B 1 50 LYS 50 50 50 LYS LYS B . n B 1 51 MET 51 51 51 MET MET B . n B 1 52 GLY 52 52 52 GLY GLY B . n B 1 53 LYS 53 53 53 LYS LYS B . n B 1 54 GLY 54 54 54 GLY GLY B . n B 1 55 ILE 55 55 55 ILE ILE B . n B 1 56 THR 56 56 56 THR THR B . n B 1 57 LEU 57 57 57 LEU LEU B . n B 1 58 SER 58 58 58 SER SER B . n B 1 59 GLU 59 59 59 GLU GLU B . n B 1 60 GLU 60 60 60 GLU GLU B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 PHE 62 62 62 PHE PHE B . n B 1 63 GLY 63 63 63 GLY GLY B . n B 1 64 VAL 64 64 64 VAL VAL B . n B 1 65 LEU 65 65 65 LEU LEU B . n B 1 66 LEU 66 66 66 LEU LEU B . n B 1 67 LYS 67 67 67 LYS LYS B . n B 1 68 GLU 68 68 68 GLU GLU B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 GLY 70 70 70 GLY GLY B . n B 1 71 ASN 71 71 71 ASN ASN B . n B 1 72 LYS 72 72 72 LYS LYS B . n B 1 73 LEU 73 73 73 LEU LEU B . n B 1 74 GLU 74 74 74 GLU GLU B . n B 1 75 HIS 75 75 75 HIS HIS B . n B 1 76 HIS 76 76 76 HIS HIS B . n B 1 77 HIS 77 77 77 HIS HIS B . n B 1 78 HIS 78 78 78 HIS HIS B . n B 1 79 HIS 79 79 79 HIS HIS B . n B 1 80 HIS 80 80 80 HIS HIS B . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-06-06 2 'Structure model' 1 1 2013-01-16 3 'Structure model' 1 2 2013-01-30 4 'Structure model' 1 3 2013-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id KR150.020-1 1.1 ? mM '[U-100% 13C; U-100% 15N]' 1 NaN3-2 0.02 ? % ? 1 DTT-3 10 ? mM ? 1 NaCL-4 100 ? mM ? 1 D2O-5 10 ? % ? 1 DSS-6 50 ? uM ? 1 TRIS-HCl-7 10 ? mM ? 1 KR150.020-8 0.697 ? mM '[U-5% 13C; U-100% 15N]' 2 NaN3-9 0.02 ? % ? 2 DTT-10 10 ? mM ? 2 NaCL-11 100 ? mM ? 2 D2O-12 10 ? % ? 2 DSS-13 50 ? uM ? 2 TRIS-HCl-14 10 ? mM ? 2 KR150.019-15 1.2 ? mM ? 3 NaN3-16 0.02 ? % ? 3 DTT-17 10 ? mM ? 3 NaCL-18 100 ? mM ? 3 D2O-19 10 ? % ? 3 DSS-20 50 ? uM ? 3 TRIS-HCl-21 10 ? mM ? 3 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 16 _pdbx_validate_close_contact.auth_atom_id_1 HZ2 _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 TRP _pdbx_validate_close_contact.auth_seq_id_1 32 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HH12 _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 42 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.34 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 17 ? ? 176.06 166.59 2 1 TRP A 23 ? ? -41.73 106.59 3 1 SER B 17 ? ? 179.43 161.01 4 1 TRP B 23 ? ? -41.97 108.04 5 1 ALA B 35 ? ? -101.56 -157.22 6 1 HIS B 76 ? ? -68.54 91.48 7 2 TRP A 23 ? ? -43.32 107.38 8 2 ASP B 3 ? ? -64.53 -70.66 9 2 TRP B 23 ? ? -46.50 109.64 10 2 HIS B 48 ? ? 59.00 19.74 11 2 HIS B 75 ? ? -174.80 132.38 12 2 HIS B 77 ? ? 165.34 172.78 13 3 LEU A 13 ? ? -105.94 -60.52 14 3 HIS A 79 ? ? -110.41 -140.44 15 3 ALA B 2 ? ? -150.38 69.87 16 3 LEU B 13 ? ? -102.97 -60.86 17 3 SER B 17 ? ? 174.94 165.70 18 3 TRP B 23 ? ? -41.58 108.11 19 3 ASN B 28 ? ? -128.38 -165.03 20 3 HIS B 78 ? ? -66.72 80.38 21 4 ALA A 2 ? ? -110.66 54.25 22 4 ASP A 3 ? ? -68.47 -71.60 23 4 LEU A 13 ? ? -95.10 -60.47 24 4 TRP A 23 ? ? -35.94 101.62 25 4 ARG A 42 ? ? -176.48 -175.44 26 4 HIS A 78 ? ? -52.83 99.74 27 4 LEU B 13 ? ? -97.73 -61.03 28 4 TRP B 23 ? ? -36.40 100.14 29 4 HIS B 48 ? ? 59.06 15.71 30 4 HIS B 75 ? ? -68.45 95.33 31 5 TRP A 23 ? ? -43.10 107.85 32 5 HIS A 78 ? ? -136.04 -48.44 33 5 HIS A 79 ? ? 70.69 109.86 34 5 TRP B 23 ? ? -39.47 107.69 35 5 ALA B 35 ? ? -104.50 -169.49 36 5 ARG B 42 ? ? -171.70 -177.20 37 5 LYS B 72 ? ? -54.63 -8.25 38 6 LEU A 13 ? ? -104.04 -62.40 39 6 ARG A 42 ? ? -174.89 -176.07 40 6 HIS A 48 ? ? 56.14 16.88 41 6 HIS A 79 ? ? 47.20 26.18 42 6 ASP B 3 ? ? -92.61 -68.26 43 6 LEU B 13 ? ? -100.50 -60.91 44 6 HIS B 76 ? ? 62.74 87.74 45 6 HIS B 77 ? ? -52.97 99.04 46 7 TRP A 23 ? ? -45.58 107.33 47 7 HIS A 75 ? ? -102.98 66.29 48 7 SER B 17 ? ? -173.14 145.93 49 7 GLU B 74 ? ? -104.48 -60.20 50 7 HIS B 76 ? ? -68.19 92.39 51 8 ALA A 2 ? ? -64.71 85.50 52 8 LEU A 13 ? ? -109.53 -61.43 53 8 TRP A 23 ? ? -45.13 107.70 54 8 HIS A 77 ? ? -106.80 70.58 55 8 HIS A 79 ? ? -114.08 -147.58 56 8 LEU B 13 ? ? -90.39 -61.06 57 9 HIS A 48 ? ? 58.58 16.81 58 9 HIS A 78 ? ? -66.51 94.55 59 9 LEU B 13 ? ? -90.20 -60.53 60 9 TRP B 23 ? ? -44.38 106.73 61 9 HIS B 48 ? ? 56.95 13.90 62 9 GLU B 74 ? ? -77.69 -78.31 63 9 HIS B 77 ? ? -69.11 87.47 64 9 HIS B 78 ? ? -52.84 99.29 65 10 LYS A 4 ? ? -168.35 117.06 66 10 LEU A 13 ? ? -93.65 -61.31 67 10 HIS A 76 ? ? -66.02 83.22 68 10 HIS A 78 ? ? -167.74 -74.73 69 10 ALA B 2 ? ? -152.82 57.17 70 10 LYS B 4 ? ? -162.83 101.28 71 10 LEU B 13 ? ? -94.94 -61.88 72 10 ARG B 42 ? ? -172.38 -174.26 73 10 HIS B 48 ? ? 56.34 12.91 74 10 HIS B 78 ? ? -157.07 1.96 75 10 HIS B 79 ? ? -164.74 103.29 76 11 TRP A 23 ? ? -41.31 108.43 77 11 ARG A 42 ? ? -176.54 -175.34 78 11 LYS A 72 ? ? -68.90 16.14 79 11 TRP B 23 ? ? -46.48 107.25 80 11 GLU B 36 ? ? -47.57 109.55 81 11 ARG B 42 ? ? -170.69 -176.40 82 11 HIS B 76 ? ? 48.47 81.60 83 11 HIS B 77 ? ? -107.67 -71.62 84 12 LYS A 4 ? ? -173.19 111.53 85 12 HIS A 75 ? ? -59.82 92.95 86 12 LEU B 13 ? ? -99.61 -60.74 87 12 HIS B 77 ? ? -83.67 -80.72 88 12 HIS B 78 ? ? -137.37 -152.39 89 13 TRP A 23 ? ? -37.39 105.39 90 13 ALA A 35 ? ? -101.47 -162.57 91 13 ARG A 42 ? ? -171.52 -179.14 92 13 HIS A 48 ? ? 58.88 16.59 93 13 LYS A 72 ? ? -54.21 -4.00 94 13 LEU B 13 ? ? -108.30 -61.41 95 13 ARG B 42 ? ? -173.42 -177.22 96 13 HIS B 48 ? ? 59.22 17.44 97 13 HIS B 78 ? ? -152.10 5.82 98 14 TRP A 23 ? ? -41.14 108.95 99 14 ALA A 35 ? ? -100.51 -161.93 100 14 HIS A 76 ? ? -59.50 102.92 101 14 HIS A 79 ? ? -91.70 56.52 102 14 LEU B 13 ? ? -97.23 -60.51 103 14 SER B 17 ? ? 179.45 166.27 104 14 ALA B 35 ? ? -104.59 -164.68 105 15 LEU B 13 ? ? -98.95 -60.37 106 15 ARG B 42 ? ? -172.24 -174.77 107 15 HIS B 48 ? ? 57.94 15.92 108 15 HIS B 76 ? ? -64.27 97.26 109 16 TRP A 23 ? ? -41.93 106.60 110 16 HIS A 48 ? ? 58.53 16.80 111 16 HIS A 77 ? ? -91.80 39.09 112 16 LEU B 13 ? ? -95.94 -60.94 113 16 HIS B 79 ? ? -160.36 -168.00 114 17 TRP A 23 ? ? -42.11 109.24 115 17 HIS A 48 ? ? 58.32 19.47 116 17 HIS A 75 ? ? -68.64 93.20 117 17 ALA B 2 ? ? -146.80 53.90 118 17 TRP B 23 ? ? -42.64 109.29 119 17 ALA B 35 ? ? -99.10 -153.97 120 17 HIS B 79 ? ? -158.39 -149.22 121 18 TRP A 23 ? ? -44.04 109.19 122 18 HIS A 48 ? ? 53.05 19.96 123 18 ALA B 2 ? ? -140.76 55.87 124 18 TRP B 23 ? ? -47.67 108.74 125 18 HIS B 48 ? ? 57.74 14.84 126 18 HIS B 75 ? ? -66.62 81.76 127 19 HIS A 75 ? ? -22.74 -54.84 128 19 HIS A 78 ? ? -65.80 87.00 129 19 LEU B 13 ? ? -98.14 -60.50 130 19 ALA B 35 ? ? -91.55 -156.50 131 19 ARG B 42 ? ? -173.54 -175.86 132 19 HIS B 48 ? ? 59.52 18.60 133 19 HIS B 76 ? ? 58.67 -150.09 134 19 HIS B 78 ? ? 75.12 -65.68 135 20 LEU A 13 ? ? -102.65 -60.16 136 20 TRP A 23 ? ? -40.70 106.14 137 20 HIS A 75 ? ? -97.75 34.88 138 20 HIS A 77 ? ? -117.26 77.72 139 20 LYS B 4 ? ? -175.81 117.30 140 20 TRP B 23 ? ? -43.99 105.22 141 20 ALA B 35 ? ? -93.77 -159.18 142 20 LYS B 72 ? ? -49.26 -11.69 143 20 HIS B 79 ? ? -172.66 104.51 #