data_2LTM # _entry.id 2LTM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LTM pdb_00002ltm 10.2210/pdb2ltm/pdb RCSB RCSB102818 ? ? BMRB 18489 ? ? WWPDB D_1000102818 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18489 BMRB unspecified . NESG-HR2876B TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LTM _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-05-29 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category CASP _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Xiao, R.' 2 'Janjua, H.' 3 'Hamilton, K.' 4 'Shastry, R.' 5 'Kohan, E.' 6 'Acton, T.B.' 7 'Everett, J.K.' 8 'Lee, H.' 9 'Huang, Y.J.' 10 'Montelione, G.T.' 11 'Northeast Structural Genomics Consortium (NESG)' 12 'Mitochondrial Protein Partnership (MPP)' 13 # _citation.id primary _citation.title ;Solution NMR Structure of NFU1 Iron-Sulfur Cluster Scaffold Homolog from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR2876B ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, G.' 1 ? primary 'Xiao, R.' 2 ? primary 'Janjua, H.' 3 ? primary 'Hamilton, K.' 4 ? primary 'Shastry, R.' 5 ? primary 'Kohan, E.' 6 ? primary 'Acton, T.B.' 7 ? primary 'Everett, J.K.' 8 ? primary 'Lee, H.' 9 ? primary 'Huang, Y.J.' 10 ? primary 'Montelione, G.T.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'NFU1 iron-sulfur cluster scaffold homolog, mitochondrial' _entity.formula_weight 12201.863 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 59-155' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HIRA-interacting protein 5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHSHMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDSITVTKENEEL DWNLLKPDIYATIMDFFASGLPLVTEE ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHSHMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDSITVTKENEEL DWNLLKPDIYATIMDFFASGLPLVTEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-HR2876B # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 HIS n 1 11 MET n 1 12 PHE n 1 13 ILE n 1 14 GLN n 1 15 THR n 1 16 GLN n 1 17 ASP n 1 18 THR n 1 19 PRO n 1 20 ASN n 1 21 PRO n 1 22 ASN n 1 23 SER n 1 24 LEU n 1 25 LYS n 1 26 PHE n 1 27 ILE n 1 28 PRO n 1 29 GLY n 1 30 LYS n 1 31 PRO n 1 32 VAL n 1 33 LEU n 1 34 GLU n 1 35 THR n 1 36 ARG n 1 37 THR n 1 38 MET n 1 39 ASP n 1 40 PHE n 1 41 PRO n 1 42 THR n 1 43 PRO n 1 44 ALA n 1 45 ALA n 1 46 ALA n 1 47 PHE n 1 48 ARG n 1 49 SER n 1 50 PRO n 1 51 LEU n 1 52 ALA n 1 53 ARG n 1 54 GLN n 1 55 LEU n 1 56 PHE n 1 57 ARG n 1 58 ILE n 1 59 GLU n 1 60 GLY n 1 61 VAL n 1 62 LYS n 1 63 SER n 1 64 VAL n 1 65 PHE n 1 66 PHE n 1 67 GLY n 1 68 PRO n 1 69 ASP n 1 70 SER n 1 71 ILE n 1 72 THR n 1 73 VAL n 1 74 THR n 1 75 LYS n 1 76 GLU n 1 77 ASN n 1 78 GLU n 1 79 GLU n 1 80 LEU n 1 81 ASP n 1 82 TRP n 1 83 ASN n 1 84 LEU n 1 85 LEU n 1 86 LYS n 1 87 PRO n 1 88 ASP n 1 89 ILE n 1 90 TYR n 1 91 ALA n 1 92 THR n 1 93 ILE n 1 94 MET n 1 95 ASP n 1 96 PHE n 1 97 PHE n 1 98 ALA n 1 99 SER n 1 100 GLY n 1 101 LEU n 1 102 PRO n 1 103 LEU n 1 104 VAL n 1 105 THR n 1 106 GLU n 1 107 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CGI-33, HIRIP5, NFU1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET15_NESG _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NFU1_HUMAN _struct_ref.pdbx_db_accession Q9UMS0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIY ATIMDFFASGLPLVTEE ; _struct_ref.pdbx_align_begin 59 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LTM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 11 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 107 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UMS0 _struct_ref_seq.db_align_beg 59 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 155 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 11 _struct_ref_seq.pdbx_auth_seq_align_end 107 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LTM MET A 1 ? UNP Q9UMS0 ? ? 'expression tag' 1 1 1 2LTM GLY A 2 ? UNP Q9UMS0 ? ? 'expression tag' 2 2 1 2LTM HIS A 3 ? UNP Q9UMS0 ? ? 'expression tag' 3 3 1 2LTM HIS A 4 ? UNP Q9UMS0 ? ? 'expression tag' 4 4 1 2LTM HIS A 5 ? UNP Q9UMS0 ? ? 'expression tag' 5 5 1 2LTM HIS A 6 ? UNP Q9UMS0 ? ? 'expression tag' 6 6 1 2LTM HIS A 7 ? UNP Q9UMS0 ? ? 'expression tag' 7 7 1 2LTM HIS A 8 ? UNP Q9UMS0 ? ? 'expression tag' 8 8 1 2LTM SER A 9 ? UNP Q9UMS0 ? ? 'expression tag' 9 9 1 2LTM HIS A 10 ? UNP Q9UMS0 ? ? 'expression tag' 10 10 1 2LTM SER A 70 ? UNP Q9UMS0 PHE 118 conflict 70 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' 1 8 3 '2D 1H-15N HSQC' 1 9 2 '2D 1H-13C HSQC aliphatic' 1 10 1 '3D HCCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.896 mM [U-100% 13C; U-100% 15N] HR2876B.035, 100 mM NaCl, 5 mM DTT, 0.02 % NaN3, 10 mM Tris-HCl pH 7.5, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.92 mM [U-5% 13C; U-100% 15N] HR2876B.037, 100 mM NaCl, 5 mM DTT, 0.02 % NaN3, 10 mM Tris-HCl pH 7.5, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '0.92 mM [U-5% 13C; U-100% 15N] HR2876B.039, 100 mM NaCl, 5 mM DTT, 0.02 % NaN3, 10 mM Tris-HCl pH 7.5, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' 600 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LTM _pdbx_nmr_refine.method 'distance geometry, simulated annealing, torsion angle dynamics, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LTM _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LTM _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.1 7 'Huang, Tejero, Powers and Montelione' refinement AutoStructure 2.1 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis' AutoAssign 2.1 9 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.1 10 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 11 'Bartels et al.' 'data analysis' XEASY ? 12 'Bartels et al.' 'peak picking' XEASY ? 13 'Bartels et al.' 'chemical shift assignment' XEASY ? 14 'Bruker Biospin' collection TopSpin ? 15 Varian collection VnmrJ ? 16 Goddard 'data analysis' Sparky ? 17 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 18 'PALES (Zweckstetter, Bax)' 'geometry optimization' PALES ? 19 'Valafar, Prestegard' 'geometry optimization' REDCAT ? 20 'Bhattacharya, Montelione' 'structure validation' PSVS ? 21 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LTM _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LTM _struct.title ;Solution NMR Structure of NFU1 Iron-Sulfur Cluster Scaffold Homolog from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR2876B ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LTM _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text ;Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, Mitochondrial Protein Partnership, MPP, PSI-Biology, Protein Structure Initiative, ELECTRON TRANSPORT ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 5 ? SER A 9 ? HIS A 5 SER A 9 5 ? 5 HELX_P HELX_P2 2 ALA A 44 ? ARG A 48 ? ALA A 44 ARG A 48 5 ? 5 HELX_P HELX_P3 3 SER A 49 ? PHE A 56 ? SER A 49 PHE A 56 1 ? 8 HELX_P HELX_P4 4 ASP A 81 ? GLY A 100 ? ASP A 81 GLY A 100 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 14 ? GLN A 16 ? GLN A 14 GLN A 16 A 2 SER A 23 ? ILE A 27 ? SER A 23 ILE A 27 A 3 SER A 70 ? LYS A 75 ? SER A 70 LYS A 75 A 4 VAL A 61 ? GLY A 67 ? VAL A 61 GLY A 67 A 5 MET A 38 ? PHE A 40 ? MET A 38 PHE A 40 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLN A 14 ? N GLN A 14 O ILE A 27 ? O ILE A 27 A 2 3 N LEU A 24 ? N LEU A 24 O VAL A 73 ? O VAL A 73 A 3 4 O SER A 70 ? O SER A 70 N GLY A 67 ? N GLY A 67 A 4 5 O PHE A 66 ? O PHE A 66 N MET A 38 ? N MET A 38 # _atom_sites.entry_id 2LTM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 TRP 82 82 82 TRP TRP A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 GLU 107 107 107 GLU GLU A . n # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Northeast Structural Genomics Consortium' 1 NESG PSI:Biology 'Mitochondrial Protein Partnership' 2 MPP PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-07-25 2 'Structure model' 1 1 2012-08-01 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id HR2876B.035-1 0.896 ? mM '[U-100% 13C; U-100% 15N]' 1 NaCl-2 100 ? mM ? 1 DTT-3 5 ? mM ? 1 NaN3-4 0.02 ? % ? 1 'Tris-HCl pH 7.5-5' 10 ? mM ? 1 HR2876B.037-6 0.92 ? mM '[U-5% 13C; U-100% 15N]' 2 NaCl-7 100 ? mM ? 2 DTT-8 5 ? mM ? 2 NaN3-9 0.02 ? % ? 2 'Tris-HCl pH 7.5-10' 10 ? mM ? 2 HR2876B.039-11 0.92 ? mM '[U-5% 13C; U-100% 15N]' 3 NaCl-12 100 ? mM ? 3 DTT-13 5 ? mM ? 3 NaN3-14 0.02 ? % ? 3 'Tris-HCl pH 7.5-15' 10 ? mM ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 8 ? ? -156.03 74.11 2 1 PRO A 19 ? ? -76.11 30.46 3 1 PRO A 31 ? ? -61.04 99.41 4 2 HIS A 6 ? ? 53.65 78.27 5 2 PRO A 31 ? ? -67.98 99.57 6 2 ARG A 36 ? ? -162.39 -168.68 7 2 GLU A 59 ? ? -65.40 92.55 8 3 HIS A 8 ? ? -95.09 38.11 9 3 SER A 9 ? ? -66.70 88.94 10 3 GLU A 59 ? ? -64.71 99.98 11 3 ASP A 69 ? ? 80.76 -28.29 12 4 PRO A 19 ? ? -38.24 -35.28 13 4 GLU A 59 ? ? -63.13 99.27 14 5 HIS A 4 ? ? -62.52 93.50 15 5 PRO A 31 ? ? -69.61 78.74 16 6 PRO A 31 ? ? -67.12 92.04 17 6 GLU A 34 ? ? -90.51 35.33 18 6 THR A 35 ? ? -134.96 -32.59 19 6 PRO A 68 ? ? -59.47 101.75 20 7 HIS A 5 ? ? -166.67 99.84 21 7 HIS A 7 ? ? -55.66 107.07 22 7 HIS A 8 ? ? -113.38 -154.57 23 8 LEU A 33 ? ? -150.23 83.28 24 8 PRO A 68 ? ? -61.92 96.16 25 9 HIS A 3 ? ? 47.52 -74.51 26 9 HIS A 6 ? ? -152.76 86.54 27 9 GLU A 59 ? ? -66.22 97.34 28 10 MET A 11 ? ? 41.94 70.19 29 10 PHE A 12 ? ? -66.70 86.32 30 10 LEU A 33 ? ? -150.61 61.09 31 10 PRO A 68 ? ? -58.90 96.02 32 11 PRO A 31 ? ? -64.35 93.22 33 12 HIS A 6 ? ? -164.87 22.65 34 12 HIS A 10 ? ? -138.40 -49.97 35 12 VAL A 32 ? ? -129.71 -52.56 36 12 LEU A 33 ? ? -153.73 72.53 37 12 PRO A 68 ? ? -52.88 93.92 38 13 HIS A 7 ? ? -68.88 88.38 39 13 PRO A 19 ? ? -57.27 -7.35 40 13 PRO A 31 ? ? -60.39 94.05 41 14 HIS A 3 ? ? -155.87 54.51 42 14 HIS A 7 ? ? -45.76 103.74 43 14 GLU A 34 ? ? -154.63 -45.33 44 14 GLU A 59 ? ? -68.36 89.56 45 14 ASP A 69 ? ? 79.41 -20.48 46 14 THR A 105 ? ? -95.07 -62.94 47 15 SER A 9 ? ? -148.83 -31.65 48 15 ARG A 36 ? ? -164.52 -168.07 49 16 HIS A 8 ? ? -165.10 100.55 50 16 SER A 9 ? ? -150.64 70.45 51 17 HIS A 5 ? ? -163.88 -36.55 52 17 SER A 9 ? ? -169.90 76.97 53 17 MET A 11 ? ? -156.16 67.21 54 17 PRO A 31 ? ? -65.15 92.94 55 17 ARG A 36 ? ? -161.29 -168.80 56 17 PRO A 68 ? ? -59.03 101.86 57 18 HIS A 7 ? ? -168.95 -49.02 58 18 LEU A 33 ? ? -159.55 63.12 59 18 PRO A 68 ? ? -54.60 92.27 60 19 PRO A 31 ? ? -66.30 99.19 61 19 ALA A 46 ? ? -67.27 0.10 62 19 PRO A 68 ? ? -54.91 109.52 63 20 HIS A 5 ? ? 37.87 58.45 64 20 MET A 11 ? ? 46.29 79.49 65 20 PRO A 31 ? ? -67.78 91.35 66 20 ARG A 36 ? ? -165.20 -165.26 67 20 PRO A 68 ? ? -55.15 103.45 #