data_2LTP # _entry.id 2LTP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LTP pdb_00002ltp 10.2210/pdb2ltp/pdb RCSB RCSB102820 ? ? BMRB 18492 ? ? WWPDB D_1000102820 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18492 BMRB unspecified . NESG-HR4636 TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LTP _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-05-30 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Montecchio, M.' 1 'Lemak, A.' 2 'Yee, A.' 3 'Xu, C.' 4 'Garcia, M.' 5 'Houliston, S.' 6 'Bellanda, M.' 7 'Min, J.' 8 'Montelione, G.T.' 9 'Arrowsmith, C.' 10 'Northeast Structural Genomics Consortium (NESG)' 11 'Structural Genomics Consortium (SGC)' 12 # _citation.id primary _citation.title 'Solution structure of the SANT2 domain of the human nuclear receptor corepressor 2 (NCoR2).' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Montecchio, M.' 1 ? primary 'Lemak, A.' 2 ? primary 'Yee, A.' 3 ? primary 'Xu, C.' 4 ? primary 'Garcia, M.' 5 ? primary 'Houliston, S.' 6 ? primary 'Bellanda, M.' 7 ? primary 'Min, J.' 8 ? primary 'Montelione, G.T.' 9 ? primary 'Arrowsmith, C.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Nuclear receptor corepressor 2' _entity.formula_weight 10776.375 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SANT 2 domain residues 615-685' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;N-CoR2, CTG repeat protein 26, SMAP270, Silencing mediator of retinoic acid and thyroid hormone receptor, SMRT, T3 receptor-associating factor, TRAC, Thyroid-, retinoic-acid-receptor-associated corepressor ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGRENLYFQGWTEEEMGTAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKMEKE RNARRKKKK ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGRENLYFQGWTEEEMGTAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKMEKE RNARRKKKK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-HR4636 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 ARG n 1 12 GLU n 1 13 ASN n 1 14 LEU n 1 15 TYR n 1 16 PHE n 1 17 GLN n 1 18 GLY n 1 19 TRP n 1 20 THR n 1 21 GLU n 1 22 GLU n 1 23 GLU n 1 24 MET n 1 25 GLY n 1 26 THR n 1 27 ALA n 1 28 LYS n 1 29 LYS n 1 30 GLY n 1 31 LEU n 1 32 LEU n 1 33 GLU n 1 34 HIS n 1 35 GLY n 1 36 ARG n 1 37 ASN n 1 38 TRP n 1 39 SER n 1 40 ALA n 1 41 ILE n 1 42 ALA n 1 43 ARG n 1 44 MET n 1 45 VAL n 1 46 GLY n 1 47 SER n 1 48 LYS n 1 49 THR n 1 50 VAL n 1 51 SER n 1 52 GLN n 1 53 CYS n 1 54 LYS n 1 55 ASN n 1 56 PHE n 1 57 TYR n 1 58 PHE n 1 59 ASN n 1 60 TYR n 1 61 LYS n 1 62 LYS n 1 63 ARG n 1 64 GLN n 1 65 ASN n 1 66 LEU n 1 67 ASP n 1 68 GLU n 1 69 ILE n 1 70 LEU n 1 71 GLN n 1 72 GLN n 1 73 HIS n 1 74 LYS n 1 75 LEU n 1 76 LYS n 1 77 MET n 1 78 GLU n 1 79 LYS n 1 80 GLU n 1 81 ARG n 1 82 ASN n 1 83 ALA n 1 84 ARG n 1 85 ARG n 1 86 LYS n 1 87 LYS n 1 88 LYS n 1 89 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NCOR2, CTG26' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PET28-MHL _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NCOR2_HUMAN _struct_ref.pdbx_db_accession Q9Y618 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code WTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKMEKERNARRKKKK _struct_ref.pdbx_align_begin 615 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LTP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 19 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y618 _struct_ref_seq.db_align_beg 615 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 685 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 71 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LTP MET A 1 ? UNP Q9Y618 ? ? 'expression tag' -17 1 1 2LTP HIS A 2 ? UNP Q9Y618 ? ? 'expression tag' -16 2 1 2LTP HIS A 3 ? UNP Q9Y618 ? ? 'expression tag' -15 3 1 2LTP HIS A 4 ? UNP Q9Y618 ? ? 'expression tag' -14 4 1 2LTP HIS A 5 ? UNP Q9Y618 ? ? 'expression tag' -13 5 1 2LTP HIS A 6 ? UNP Q9Y618 ? ? 'expression tag' -12 6 1 2LTP HIS A 7 ? UNP Q9Y618 ? ? 'expression tag' -11 7 1 2LTP SER A 8 ? UNP Q9Y618 ? ? 'expression tag' -10 8 1 2LTP SER A 9 ? UNP Q9Y618 ? ? 'expression tag' -9 9 1 2LTP GLY A 10 ? UNP Q9Y618 ? ? 'expression tag' -8 10 1 2LTP ARG A 11 ? UNP Q9Y618 ? ? 'expression tag' -7 11 1 2LTP GLU A 12 ? UNP Q9Y618 ? ? 'expression tag' -6 12 1 2LTP ASN A 13 ? UNP Q9Y618 ? ? 'expression tag' -5 13 1 2LTP LEU A 14 ? UNP Q9Y618 ? ? 'expression tag' -4 14 1 2LTP TYR A 15 ? UNP Q9Y618 ? ? 'expression tag' -3 15 1 2LTP PHE A 16 ? UNP Q9Y618 ? ? 'expression tag' -2 16 1 2LTP GLN A 17 ? UNP Q9Y618 ? ? 'expression tag' -1 17 1 2LTP GLY A 18 ? UNP Q9Y618 ? ? 'expression tag' 0 18 1 2LTP GLY A 25 ? UNP Q9Y618 GLU 621 conflict 7 19 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCO' 1 4 1 '3D HNCA' 1 5 1 '3D HBHA(CO)NH' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '2D 1H-13C HSQC aliphatic' 1 8 1 '2D 1H-13C HSQC aromatic' 1 9 1 '3D 1H-13C NOESY aliphatic' 1 10 1 '3D 1H-13C NOESY aromatic' 1 11 1 '3D HCCH-TOCSY' 1 12 1 '3D HCCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;1 mM [U-13C; U-15N] protein 1, 25 mM sodium phosphate, 200 mM NaCl, 0.01 mM ZnSO4, 10 mM DTT, 1 mM benzamidine, 0.01 % NaN3, 95 % H2O, 5 % D2O, 95% H2O/5% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LTP _pdbx_nmr_refine.method 'restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LTP _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LTP _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 2 Goddard 'peak picking' Sparky ? 3 'Gutmanas A., Orekhov V.' processing MDDGUI ? 4 'Lemak A., Steren C., Llinas M., Arrowsmith C.' 'chemical shift assignment' FMCGUI ? 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 6 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 7 'Bhattacharya and Montelione' 'structure validation' PSVS ? 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LTP _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LTP _struct.title ;Solution structure of the SANT2 domain of the human nuclear receptor corepressor 2 (NCoR2), Northeast Structural Genomics Consortium (NESG) target ID HR4636E ; _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LTP _struct_keywords.pdbx_keywords 'Transcription regulator' _struct_keywords.text ;SMRT, TRAC, SGC, Structural Genomics Consortium, NESG, Northeast Structural Genomics Consortium, Transcription regulator, PSI-Biology ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 20 ? HIS A 34 ? THR A 2 HIS A 16 1 ? 15 HELX_P HELX_P2 2 ASN A 37 ? VAL A 45 ? ASN A 19 VAL A 27 1 ? 9 HELX_P HELX_P3 3 THR A 49 ? TYR A 60 ? THR A 31 TYR A 42 1 ? 12 HELX_P HELX_P4 4 GLN A 64 ? ARG A 84 ? GLN A 46 ARG A 66 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2LTP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -17 ? ? ? A . n A 1 2 HIS 2 -16 ? ? ? A . n A 1 3 HIS 3 -15 ? ? ? A . n A 1 4 HIS 4 -14 ? ? ? A . n A 1 5 HIS 5 -13 ? ? ? A . n A 1 6 HIS 6 -12 ? ? ? A . n A 1 7 HIS 7 -11 ? ? ? A . n A 1 8 SER 8 -10 ? ? ? A . n A 1 9 SER 9 -9 ? ? ? A . n A 1 10 GLY 10 -8 ? ? ? A . n A 1 11 ARG 11 -7 ? ? ? A . n A 1 12 GLU 12 -6 ? ? ? A . n A 1 13 ASN 13 -5 ? ? ? A . n A 1 14 LEU 14 -4 ? ? ? A . n A 1 15 TYR 15 -3 ? ? ? A . n A 1 16 PHE 16 -2 ? ? ? A . n A 1 17 GLN 17 -1 ? ? ? A . n A 1 18 GLY 18 0 ? ? ? A . n A 1 19 TRP 19 1 1 TRP TRP A . n A 1 20 THR 20 2 2 THR THR A . n A 1 21 GLU 21 3 3 GLU GLU A . n A 1 22 GLU 22 4 4 GLU GLU A . n A 1 23 GLU 23 5 5 GLU GLU A . n A 1 24 MET 24 6 6 MET MET A . n A 1 25 GLY 25 7 7 GLY GLY A . n A 1 26 THR 26 8 8 THR THR A . n A 1 27 ALA 27 9 9 ALA ALA A . n A 1 28 LYS 28 10 10 LYS LYS A . n A 1 29 LYS 29 11 11 LYS LYS A . n A 1 30 GLY 30 12 12 GLY GLY A . n A 1 31 LEU 31 13 13 LEU LEU A . n A 1 32 LEU 32 14 14 LEU LEU A . n A 1 33 GLU 33 15 15 GLU GLU A . n A 1 34 HIS 34 16 16 HIS HIS A . n A 1 35 GLY 35 17 17 GLY GLY A . n A 1 36 ARG 36 18 18 ARG ARG A . n A 1 37 ASN 37 19 19 ASN ASN A . n A 1 38 TRP 38 20 20 TRP TRP A . n A 1 39 SER 39 21 21 SER SER A . n A 1 40 ALA 40 22 22 ALA ALA A . n A 1 41 ILE 41 23 23 ILE ILE A . n A 1 42 ALA 42 24 24 ALA ALA A . n A 1 43 ARG 43 25 25 ARG ARG A . n A 1 44 MET 44 26 26 MET MET A . n A 1 45 VAL 45 27 27 VAL VAL A . n A 1 46 GLY 46 28 28 GLY GLY A . n A 1 47 SER 47 29 29 SER SER A . n A 1 48 LYS 48 30 30 LYS LYS A . n A 1 49 THR 49 31 31 THR THR A . n A 1 50 VAL 50 32 32 VAL VAL A . n A 1 51 SER 51 33 33 SER SER A . n A 1 52 GLN 52 34 34 GLN GLN A . n A 1 53 CYS 53 35 35 CYS CYS A . n A 1 54 LYS 54 36 36 LYS LYS A . n A 1 55 ASN 55 37 37 ASN ASN A . n A 1 56 PHE 56 38 38 PHE PHE A . n A 1 57 TYR 57 39 39 TYR TYR A . n A 1 58 PHE 58 40 40 PHE PHE A . n A 1 59 ASN 59 41 41 ASN ASN A . n A 1 60 TYR 60 42 42 TYR TYR A . n A 1 61 LYS 61 43 43 LYS LYS A . n A 1 62 LYS 62 44 44 LYS LYS A . n A 1 63 ARG 63 45 45 ARG ARG A . n A 1 64 GLN 64 46 46 GLN GLN A . n A 1 65 ASN 65 47 47 ASN ASN A . n A 1 66 LEU 66 48 48 LEU LEU A . n A 1 67 ASP 67 49 49 ASP ASP A . n A 1 68 GLU 68 50 50 GLU GLU A . n A 1 69 ILE 69 51 51 ILE ILE A . n A 1 70 LEU 70 52 52 LEU LEU A . n A 1 71 GLN 71 53 53 GLN GLN A . n A 1 72 GLN 72 54 54 GLN GLN A . n A 1 73 HIS 73 55 55 HIS HIS A . n A 1 74 LYS 74 56 56 LYS LYS A . n A 1 75 LEU 75 57 57 LEU LEU A . n A 1 76 LYS 76 58 58 LYS LYS A . n A 1 77 MET 77 59 59 MET MET A . n A 1 78 GLU 78 60 60 GLU GLU A . n A 1 79 LYS 79 61 61 LYS LYS A . n A 1 80 GLU 80 62 62 GLU GLU A . n A 1 81 ARG 81 63 63 ARG ARG A . n A 1 82 ASN 82 64 64 ASN ASN A . n A 1 83 ALA 83 65 65 ALA ALA A . n A 1 84 ARG 84 66 66 ARG ARG A . n A 1 85 ARG 85 67 67 ARG ARG A . n A 1 86 LYS 86 68 68 LYS LYS A . n A 1 87 LYS 87 69 69 LYS LYS A . n A 1 88 LYS 88 70 70 LYS LYS A . n A 1 89 LYS 89 71 71 LYS LYS A . n # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Northeast Structural Genomics Consortium' 1 NESG PSI:Biology 'Structural Genomics Consortium' 2 SGC ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-06-20 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'entity 1-1' 1 ? mM '[U-13C; U-15N]' 1 'sodium phosphate-2' 25 ? mM ? 1 NaCl-3 200 ? mM ? 1 ZnSO4-4 0.01 ? mM ? 1 DTT-5 10 ? mM ? 1 benzamidine-6 1 ? mM ? 1 NaN3-7 0.01 ? % ? 1 H2O-8 95 ? % ? 1 D2O-9 5 ? % ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 30 ? ? -149.90 -74.28 2 1 TYR A 42 ? ? -94.06 35.76 3 1 LYS A 43 ? ? -68.89 90.03 4 1 GLN A 46 ? ? -120.32 -66.10 5 1 ARG A 67 ? ? -99.49 38.93 6 2 GLU A 15 ? ? -106.94 -63.78 7 2 ASN A 19 ? ? -66.74 94.43 8 2 THR A 31 ? ? -49.07 151.31 9 2 ASN A 41 ? ? -98.09 -65.85 10 2 TYR A 42 ? ? -73.68 -76.73 11 2 GLN A 46 ? ? 77.59 -41.05 12 3 GLU A 15 ? ? -97.14 -63.30 13 3 ASN A 19 ? ? -69.63 92.38 14 3 LYS A 30 ? ? -143.38 -91.27 15 3 LYS A 44 ? ? -66.67 86.70 16 3 ASN A 47 ? ? -138.03 -49.67 17 3 LYS A 69 ? ? -151.62 82.75 18 4 LYS A 30 ? ? -122.40 -79.64 19 4 PHE A 40 ? ? -95.75 -60.62 20 4 LYS A 44 ? ? -58.36 80.20 21 5 LYS A 30 ? ? -125.25 -169.01 22 5 GLN A 46 ? ? -161.34 99.62 23 5 ASN A 47 ? ? -153.86 -91.76 24 5 LYS A 69 ? ? 60.54 76.74 25 6 GLU A 15 ? ? -93.50 -62.72 26 6 LYS A 30 ? ? -133.68 -78.23 27 6 GLN A 46 ? ? 46.17 96.54 28 7 ARG A 45 ? ? -58.64 98.90 29 7 GLN A 46 ? ? 71.34 -36.46 30 8 ARG A 18 ? ? -85.06 32.32 31 8 LYS A 30 ? ? -136.01 -69.14 32 8 ASN A 47 ? ? -82.47 46.14 33 9 ARG A 18 ? ? -82.73 50.00 34 9 LYS A 30 ? ? -140.29 -147.53 35 9 ARG A 45 ? ? 64.90 79.11 36 9 ARG A 67 ? ? -109.33 -65.11 37 10 ARG A 18 ? ? -86.06 35.43 38 10 LYS A 30 ? ? -139.04 -80.91 39 10 GLN A 46 ? ? 59.88 85.86 40 10 LYS A 70 ? ? 56.49 97.46 41 11 ASN A 19 ? ? -67.93 96.26 42 11 TYR A 42 ? ? 66.84 -10.13 43 11 LYS A 69 ? ? -107.57 52.76 44 12 ASN A 41 ? ? 78.31 -52.33 45 12 LYS A 44 ? ? -90.42 46.19 46 12 GLN A 46 ? ? 43.97 20.09 47 12 LYS A 70 ? ? 64.84 79.08 48 13 GLU A 15 ? ? -90.81 -63.03 49 13 LYS A 30 ? ? -120.99 -166.42 50 13 LYS A 44 ? ? 179.76 163.32 51 13 LYS A 69 ? ? -59.46 102.00 52 14 GLU A 15 ? ? -108.86 -64.18 53 14 ASN A 19 ? ? -62.97 92.06 54 14 LYS A 44 ? ? 28.68 74.01 55 14 ARG A 45 ? ? -150.04 -1.73 56 14 ASN A 47 ? ? -91.65 34.50 57 14 LYS A 69 ? ? -162.84 7.36 58 15 GLU A 15 ? ? -91.73 -63.21 59 15 TYR A 42 ? ? 55.72 73.11 60 16 ARG A 18 ? ? -79.26 36.77 61 17 ARG A 18 ? ? -78.44 24.48 62 17 LYS A 30 ? ? -126.70 -86.46 63 17 ARG A 45 ? ? -132.02 -49.36 64 18 ARG A 18 ? ? -83.20 43.48 65 18 LYS A 30 ? ? -149.67 -75.34 66 18 ASN A 41 ? ? -150.74 34.42 67 18 TYR A 42 ? ? -54.55 -70.18 68 18 LYS A 43 ? ? -178.24 96.39 69 19 GLU A 15 ? ? -106.17 -63.39 70 19 ASN A 19 ? ? -66.31 94.67 71 19 LYS A 30 ? ? -135.42 -77.66 72 19 LYS A 43 ? ? 63.26 -86.81 73 19 LYS A 44 ? ? -156.88 87.06 74 19 LYS A 69 ? ? -107.42 48.85 75 20 ASN A 19 ? ? -69.99 92.91 76 20 LYS A 43 ? ? -64.26 95.14 77 20 LYS A 69 ? ? -146.73 39.55 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -17 ? A MET 1 2 1 Y 1 A HIS -16 ? A HIS 2 3 1 Y 1 A HIS -15 ? A HIS 3 4 1 Y 1 A HIS -14 ? A HIS 4 5 1 Y 1 A HIS -13 ? A HIS 5 6 1 Y 1 A HIS -12 ? A HIS 6 7 1 Y 1 A HIS -11 ? A HIS 7 8 1 Y 1 A SER -10 ? A SER 8 9 1 Y 1 A SER -9 ? A SER 9 10 1 Y 1 A GLY -8 ? A GLY 10 11 1 Y 1 A ARG -7 ? A ARG 11 12 1 Y 1 A GLU -6 ? A GLU 12 13 1 Y 1 A ASN -5 ? A ASN 13 14 1 Y 1 A LEU -4 ? A LEU 14 15 1 Y 1 A TYR -3 ? A TYR 15 16 1 Y 1 A PHE -2 ? A PHE 16 17 1 Y 1 A GLN -1 ? A GLN 17 18 1 Y 1 A GLY 0 ? A GLY 18 19 2 Y 1 A MET -17 ? A MET 1 20 2 Y 1 A HIS -16 ? A HIS 2 21 2 Y 1 A HIS -15 ? A HIS 3 22 2 Y 1 A HIS -14 ? A HIS 4 23 2 Y 1 A HIS -13 ? A HIS 5 24 2 Y 1 A HIS -12 ? A HIS 6 25 2 Y 1 A HIS -11 ? A HIS 7 26 2 Y 1 A SER -10 ? A SER 8 27 2 Y 1 A SER -9 ? A SER 9 28 2 Y 1 A GLY -8 ? A GLY 10 29 2 Y 1 A ARG -7 ? A ARG 11 30 2 Y 1 A GLU -6 ? A GLU 12 31 2 Y 1 A ASN -5 ? A ASN 13 32 2 Y 1 A LEU -4 ? A LEU 14 33 2 Y 1 A TYR -3 ? A TYR 15 34 2 Y 1 A PHE -2 ? A PHE 16 35 2 Y 1 A GLN -1 ? A GLN 17 36 2 Y 1 A GLY 0 ? A GLY 18 37 3 Y 1 A MET -17 ? A MET 1 38 3 Y 1 A HIS -16 ? A HIS 2 39 3 Y 1 A HIS -15 ? A HIS 3 40 3 Y 1 A HIS -14 ? A HIS 4 41 3 Y 1 A HIS -13 ? A HIS 5 42 3 Y 1 A HIS -12 ? A HIS 6 43 3 Y 1 A HIS -11 ? A HIS 7 44 3 Y 1 A SER -10 ? A SER 8 45 3 Y 1 A SER -9 ? A SER 9 46 3 Y 1 A GLY -8 ? A GLY 10 47 3 Y 1 A ARG -7 ? A ARG 11 48 3 Y 1 A GLU -6 ? A GLU 12 49 3 Y 1 A ASN -5 ? A ASN 13 50 3 Y 1 A LEU -4 ? A LEU 14 51 3 Y 1 A TYR -3 ? A TYR 15 52 3 Y 1 A PHE -2 ? A PHE 16 53 3 Y 1 A GLN -1 ? A GLN 17 54 3 Y 1 A GLY 0 ? A GLY 18 55 4 Y 1 A MET -17 ? A MET 1 56 4 Y 1 A HIS -16 ? A HIS 2 57 4 Y 1 A HIS -15 ? A HIS 3 58 4 Y 1 A HIS -14 ? A HIS 4 59 4 Y 1 A HIS -13 ? A HIS 5 60 4 Y 1 A HIS -12 ? A HIS 6 61 4 Y 1 A HIS -11 ? A HIS 7 62 4 Y 1 A SER -10 ? A SER 8 63 4 Y 1 A SER -9 ? A SER 9 64 4 Y 1 A GLY -8 ? A GLY 10 65 4 Y 1 A ARG -7 ? A ARG 11 66 4 Y 1 A GLU -6 ? A GLU 12 67 4 Y 1 A ASN -5 ? A ASN 13 68 4 Y 1 A LEU -4 ? A LEU 14 69 4 Y 1 A TYR -3 ? A TYR 15 70 4 Y 1 A PHE -2 ? A PHE 16 71 4 Y 1 A GLN -1 ? A GLN 17 72 4 Y 1 A GLY 0 ? A GLY 18 73 5 Y 1 A MET -17 ? A MET 1 74 5 Y 1 A HIS -16 ? A HIS 2 75 5 Y 1 A HIS -15 ? A HIS 3 76 5 Y 1 A HIS -14 ? A HIS 4 77 5 Y 1 A HIS -13 ? A HIS 5 78 5 Y 1 A HIS -12 ? A HIS 6 79 5 Y 1 A HIS -11 ? A HIS 7 80 5 Y 1 A SER -10 ? A SER 8 81 5 Y 1 A SER -9 ? A SER 9 82 5 Y 1 A GLY -8 ? A GLY 10 83 5 Y 1 A ARG -7 ? A ARG 11 84 5 Y 1 A GLU -6 ? A GLU 12 85 5 Y 1 A ASN -5 ? A ASN 13 86 5 Y 1 A LEU -4 ? A LEU 14 87 5 Y 1 A TYR -3 ? A TYR 15 88 5 Y 1 A PHE -2 ? A PHE 16 89 5 Y 1 A GLN -1 ? A GLN 17 90 5 Y 1 A GLY 0 ? A GLY 18 91 6 Y 1 A MET -17 ? A MET 1 92 6 Y 1 A HIS -16 ? A HIS 2 93 6 Y 1 A HIS -15 ? A HIS 3 94 6 Y 1 A HIS -14 ? A HIS 4 95 6 Y 1 A HIS -13 ? A HIS 5 96 6 Y 1 A HIS -12 ? A HIS 6 97 6 Y 1 A HIS -11 ? A HIS 7 98 6 Y 1 A SER -10 ? A SER 8 99 6 Y 1 A SER -9 ? A SER 9 100 6 Y 1 A GLY -8 ? A GLY 10 101 6 Y 1 A ARG -7 ? A ARG 11 102 6 Y 1 A GLU -6 ? A GLU 12 103 6 Y 1 A ASN -5 ? A ASN 13 104 6 Y 1 A LEU -4 ? A LEU 14 105 6 Y 1 A TYR -3 ? A TYR 15 106 6 Y 1 A PHE -2 ? A PHE 16 107 6 Y 1 A GLN -1 ? A GLN 17 108 6 Y 1 A GLY 0 ? A GLY 18 109 7 Y 1 A MET -17 ? A MET 1 110 7 Y 1 A HIS -16 ? A HIS 2 111 7 Y 1 A HIS -15 ? A HIS 3 112 7 Y 1 A HIS -14 ? A HIS 4 113 7 Y 1 A HIS -13 ? A HIS 5 114 7 Y 1 A HIS -12 ? A HIS 6 115 7 Y 1 A HIS -11 ? A HIS 7 116 7 Y 1 A SER -10 ? A SER 8 117 7 Y 1 A SER -9 ? A SER 9 118 7 Y 1 A GLY -8 ? A GLY 10 119 7 Y 1 A ARG -7 ? A ARG 11 120 7 Y 1 A GLU -6 ? A GLU 12 121 7 Y 1 A ASN -5 ? A ASN 13 122 7 Y 1 A LEU -4 ? A LEU 14 123 7 Y 1 A TYR -3 ? A TYR 15 124 7 Y 1 A PHE -2 ? A PHE 16 125 7 Y 1 A GLN -1 ? A GLN 17 126 7 Y 1 A GLY 0 ? A GLY 18 127 8 Y 1 A MET -17 ? A MET 1 128 8 Y 1 A HIS -16 ? A HIS 2 129 8 Y 1 A HIS -15 ? A HIS 3 130 8 Y 1 A HIS -14 ? A HIS 4 131 8 Y 1 A HIS -13 ? A HIS 5 132 8 Y 1 A HIS -12 ? A HIS 6 133 8 Y 1 A HIS -11 ? A HIS 7 134 8 Y 1 A SER -10 ? A SER 8 135 8 Y 1 A SER -9 ? A SER 9 136 8 Y 1 A GLY -8 ? A GLY 10 137 8 Y 1 A ARG -7 ? A ARG 11 138 8 Y 1 A GLU -6 ? A GLU 12 139 8 Y 1 A ASN -5 ? A ASN 13 140 8 Y 1 A LEU -4 ? A LEU 14 141 8 Y 1 A TYR -3 ? A TYR 15 142 8 Y 1 A PHE -2 ? A PHE 16 143 8 Y 1 A GLN -1 ? A GLN 17 144 8 Y 1 A GLY 0 ? A GLY 18 145 9 Y 1 A MET -17 ? A MET 1 146 9 Y 1 A HIS -16 ? A HIS 2 147 9 Y 1 A HIS -15 ? A HIS 3 148 9 Y 1 A HIS -14 ? A HIS 4 149 9 Y 1 A HIS -13 ? A HIS 5 150 9 Y 1 A HIS -12 ? A HIS 6 151 9 Y 1 A HIS -11 ? A HIS 7 152 9 Y 1 A SER -10 ? A SER 8 153 9 Y 1 A SER -9 ? A SER 9 154 9 Y 1 A GLY -8 ? A GLY 10 155 9 Y 1 A ARG -7 ? A ARG 11 156 9 Y 1 A GLU -6 ? A GLU 12 157 9 Y 1 A ASN -5 ? A ASN 13 158 9 Y 1 A LEU -4 ? A LEU 14 159 9 Y 1 A TYR -3 ? A TYR 15 160 9 Y 1 A PHE -2 ? A PHE 16 161 9 Y 1 A GLN -1 ? A GLN 17 162 9 Y 1 A GLY 0 ? A GLY 18 163 10 Y 1 A MET -17 ? A MET 1 164 10 Y 1 A HIS -16 ? A HIS 2 165 10 Y 1 A HIS -15 ? A HIS 3 166 10 Y 1 A HIS -14 ? A HIS 4 167 10 Y 1 A HIS -13 ? A HIS 5 168 10 Y 1 A HIS -12 ? A HIS 6 169 10 Y 1 A HIS -11 ? A HIS 7 170 10 Y 1 A SER -10 ? A SER 8 171 10 Y 1 A SER -9 ? A SER 9 172 10 Y 1 A GLY -8 ? A GLY 10 173 10 Y 1 A ARG -7 ? A ARG 11 174 10 Y 1 A GLU -6 ? A GLU 12 175 10 Y 1 A ASN -5 ? A ASN 13 176 10 Y 1 A LEU -4 ? A LEU 14 177 10 Y 1 A TYR -3 ? A TYR 15 178 10 Y 1 A PHE -2 ? A PHE 16 179 10 Y 1 A GLN -1 ? A GLN 17 180 10 Y 1 A GLY 0 ? A GLY 18 181 11 Y 1 A MET -17 ? A MET 1 182 11 Y 1 A HIS -16 ? A HIS 2 183 11 Y 1 A HIS -15 ? A HIS 3 184 11 Y 1 A HIS -14 ? A HIS 4 185 11 Y 1 A HIS -13 ? A HIS 5 186 11 Y 1 A HIS -12 ? A HIS 6 187 11 Y 1 A HIS -11 ? A HIS 7 188 11 Y 1 A SER -10 ? A SER 8 189 11 Y 1 A SER -9 ? A SER 9 190 11 Y 1 A GLY -8 ? A GLY 10 191 11 Y 1 A ARG -7 ? A ARG 11 192 11 Y 1 A GLU -6 ? A GLU 12 193 11 Y 1 A ASN -5 ? A ASN 13 194 11 Y 1 A LEU -4 ? A LEU 14 195 11 Y 1 A TYR -3 ? A TYR 15 196 11 Y 1 A PHE -2 ? A PHE 16 197 11 Y 1 A GLN -1 ? A GLN 17 198 11 Y 1 A GLY 0 ? A GLY 18 199 12 Y 1 A MET -17 ? A MET 1 200 12 Y 1 A HIS -16 ? A HIS 2 201 12 Y 1 A HIS -15 ? A HIS 3 202 12 Y 1 A HIS -14 ? A HIS 4 203 12 Y 1 A HIS -13 ? A HIS 5 204 12 Y 1 A HIS -12 ? A HIS 6 205 12 Y 1 A HIS -11 ? A HIS 7 206 12 Y 1 A SER -10 ? A SER 8 207 12 Y 1 A SER -9 ? A SER 9 208 12 Y 1 A GLY -8 ? A GLY 10 209 12 Y 1 A ARG -7 ? A ARG 11 210 12 Y 1 A GLU -6 ? A GLU 12 211 12 Y 1 A ASN -5 ? A ASN 13 212 12 Y 1 A LEU -4 ? A LEU 14 213 12 Y 1 A TYR -3 ? A TYR 15 214 12 Y 1 A PHE -2 ? A PHE 16 215 12 Y 1 A GLN -1 ? A GLN 17 216 12 Y 1 A GLY 0 ? A GLY 18 217 13 Y 1 A MET -17 ? A MET 1 218 13 Y 1 A HIS -16 ? A HIS 2 219 13 Y 1 A HIS -15 ? A HIS 3 220 13 Y 1 A HIS -14 ? A HIS 4 221 13 Y 1 A HIS -13 ? A HIS 5 222 13 Y 1 A HIS -12 ? A HIS 6 223 13 Y 1 A HIS -11 ? A HIS 7 224 13 Y 1 A SER -10 ? A SER 8 225 13 Y 1 A SER -9 ? A SER 9 226 13 Y 1 A GLY -8 ? A GLY 10 227 13 Y 1 A ARG -7 ? A ARG 11 228 13 Y 1 A GLU -6 ? A GLU 12 229 13 Y 1 A ASN -5 ? A ASN 13 230 13 Y 1 A LEU -4 ? A LEU 14 231 13 Y 1 A TYR -3 ? A TYR 15 232 13 Y 1 A PHE -2 ? A PHE 16 233 13 Y 1 A GLN -1 ? A GLN 17 234 13 Y 1 A GLY 0 ? A GLY 18 235 14 Y 1 A MET -17 ? A MET 1 236 14 Y 1 A HIS -16 ? A HIS 2 237 14 Y 1 A HIS -15 ? A HIS 3 238 14 Y 1 A HIS -14 ? A HIS 4 239 14 Y 1 A HIS -13 ? A HIS 5 240 14 Y 1 A HIS -12 ? A HIS 6 241 14 Y 1 A HIS -11 ? A HIS 7 242 14 Y 1 A SER -10 ? A SER 8 243 14 Y 1 A SER -9 ? A SER 9 244 14 Y 1 A GLY -8 ? A GLY 10 245 14 Y 1 A ARG -7 ? A ARG 11 246 14 Y 1 A GLU -6 ? A GLU 12 247 14 Y 1 A ASN -5 ? A ASN 13 248 14 Y 1 A LEU -4 ? A LEU 14 249 14 Y 1 A TYR -3 ? A TYR 15 250 14 Y 1 A PHE -2 ? A PHE 16 251 14 Y 1 A GLN -1 ? A GLN 17 252 14 Y 1 A GLY 0 ? A GLY 18 253 15 Y 1 A MET -17 ? A MET 1 254 15 Y 1 A HIS -16 ? A HIS 2 255 15 Y 1 A HIS -15 ? A HIS 3 256 15 Y 1 A HIS -14 ? A HIS 4 257 15 Y 1 A HIS -13 ? A HIS 5 258 15 Y 1 A HIS -12 ? A HIS 6 259 15 Y 1 A HIS -11 ? A HIS 7 260 15 Y 1 A SER -10 ? A SER 8 261 15 Y 1 A SER -9 ? A SER 9 262 15 Y 1 A GLY -8 ? A GLY 10 263 15 Y 1 A ARG -7 ? A ARG 11 264 15 Y 1 A GLU -6 ? A GLU 12 265 15 Y 1 A ASN -5 ? A ASN 13 266 15 Y 1 A LEU -4 ? A LEU 14 267 15 Y 1 A TYR -3 ? A TYR 15 268 15 Y 1 A PHE -2 ? A PHE 16 269 15 Y 1 A GLN -1 ? A GLN 17 270 15 Y 1 A GLY 0 ? A GLY 18 271 16 Y 1 A MET -17 ? A MET 1 272 16 Y 1 A HIS -16 ? A HIS 2 273 16 Y 1 A HIS -15 ? A HIS 3 274 16 Y 1 A HIS -14 ? A HIS 4 275 16 Y 1 A HIS -13 ? A HIS 5 276 16 Y 1 A HIS -12 ? A HIS 6 277 16 Y 1 A HIS -11 ? A HIS 7 278 16 Y 1 A SER -10 ? A SER 8 279 16 Y 1 A SER -9 ? A SER 9 280 16 Y 1 A GLY -8 ? A GLY 10 281 16 Y 1 A ARG -7 ? A ARG 11 282 16 Y 1 A GLU -6 ? A GLU 12 283 16 Y 1 A ASN -5 ? A ASN 13 284 16 Y 1 A LEU -4 ? A LEU 14 285 16 Y 1 A TYR -3 ? A TYR 15 286 16 Y 1 A PHE -2 ? A PHE 16 287 16 Y 1 A GLN -1 ? A GLN 17 288 16 Y 1 A GLY 0 ? A GLY 18 289 17 Y 1 A MET -17 ? A MET 1 290 17 Y 1 A HIS -16 ? A HIS 2 291 17 Y 1 A HIS -15 ? A HIS 3 292 17 Y 1 A HIS -14 ? A HIS 4 293 17 Y 1 A HIS -13 ? A HIS 5 294 17 Y 1 A HIS -12 ? A HIS 6 295 17 Y 1 A HIS -11 ? A HIS 7 296 17 Y 1 A SER -10 ? A SER 8 297 17 Y 1 A SER -9 ? A SER 9 298 17 Y 1 A GLY -8 ? A GLY 10 299 17 Y 1 A ARG -7 ? A ARG 11 300 17 Y 1 A GLU -6 ? A GLU 12 301 17 Y 1 A ASN -5 ? A ASN 13 302 17 Y 1 A LEU -4 ? A LEU 14 303 17 Y 1 A TYR -3 ? A TYR 15 304 17 Y 1 A PHE -2 ? A PHE 16 305 17 Y 1 A GLN -1 ? A GLN 17 306 17 Y 1 A GLY 0 ? A GLY 18 307 18 Y 1 A MET -17 ? A MET 1 308 18 Y 1 A HIS -16 ? A HIS 2 309 18 Y 1 A HIS -15 ? A HIS 3 310 18 Y 1 A HIS -14 ? A HIS 4 311 18 Y 1 A HIS -13 ? A HIS 5 312 18 Y 1 A HIS -12 ? A HIS 6 313 18 Y 1 A HIS -11 ? A HIS 7 314 18 Y 1 A SER -10 ? A SER 8 315 18 Y 1 A SER -9 ? A SER 9 316 18 Y 1 A GLY -8 ? A GLY 10 317 18 Y 1 A ARG -7 ? A ARG 11 318 18 Y 1 A GLU -6 ? A GLU 12 319 18 Y 1 A ASN -5 ? A ASN 13 320 18 Y 1 A LEU -4 ? A LEU 14 321 18 Y 1 A TYR -3 ? A TYR 15 322 18 Y 1 A PHE -2 ? A PHE 16 323 18 Y 1 A GLN -1 ? A GLN 17 324 18 Y 1 A GLY 0 ? A GLY 18 325 19 Y 1 A MET -17 ? A MET 1 326 19 Y 1 A HIS -16 ? A HIS 2 327 19 Y 1 A HIS -15 ? A HIS 3 328 19 Y 1 A HIS -14 ? A HIS 4 329 19 Y 1 A HIS -13 ? A HIS 5 330 19 Y 1 A HIS -12 ? A HIS 6 331 19 Y 1 A HIS -11 ? A HIS 7 332 19 Y 1 A SER -10 ? A SER 8 333 19 Y 1 A SER -9 ? A SER 9 334 19 Y 1 A GLY -8 ? A GLY 10 335 19 Y 1 A ARG -7 ? A ARG 11 336 19 Y 1 A GLU -6 ? A GLU 12 337 19 Y 1 A ASN -5 ? A ASN 13 338 19 Y 1 A LEU -4 ? A LEU 14 339 19 Y 1 A TYR -3 ? A TYR 15 340 19 Y 1 A PHE -2 ? A PHE 16 341 19 Y 1 A GLN -1 ? A GLN 17 342 19 Y 1 A GLY 0 ? A GLY 18 343 20 Y 1 A MET -17 ? A MET 1 344 20 Y 1 A HIS -16 ? A HIS 2 345 20 Y 1 A HIS -15 ? A HIS 3 346 20 Y 1 A HIS -14 ? A HIS 4 347 20 Y 1 A HIS -13 ? A HIS 5 348 20 Y 1 A HIS -12 ? A HIS 6 349 20 Y 1 A HIS -11 ? A HIS 7 350 20 Y 1 A SER -10 ? A SER 8 351 20 Y 1 A SER -9 ? A SER 9 352 20 Y 1 A GLY -8 ? A GLY 10 353 20 Y 1 A ARG -7 ? A ARG 11 354 20 Y 1 A GLU -6 ? A GLU 12 355 20 Y 1 A ASN -5 ? A ASN 13 356 20 Y 1 A LEU -4 ? A LEU 14 357 20 Y 1 A TYR -3 ? A TYR 15 358 20 Y 1 A PHE -2 ? A PHE 16 359 20 Y 1 A GLN -1 ? A GLN 17 360 20 Y 1 A GLY 0 ? A GLY 18 #