data_2LTW # _entry.id 2LTW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LTW RCSB RCSB102827 BMRB 18499 WWPDB D_1000102827 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18499 BMRB unspecified . 2LTV PDB unspecified . 2LTX PDB unspecified . 2LTY PDB unspecified . 2LTZ PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LTW _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-06-04 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Macias, M.J.' 1 'Aragon, E.' 2 'Goerner, N.' 3 'Xi, Q.' 4 'Lopes, T.' 5 'Gao, S.' 6 'Massague, J.' 7 # _citation.id primary _citation.title 'Structural Basis for the Versatile Interactions of Smad7 with Regulator WW Domains in TGF-beta Pathways.' _citation.journal_abbrev Structure _citation.journal_volume 20 _citation.page_first 1726 _citation.page_last 1736 _citation.year 2012 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22921829 _citation.pdbx_database_id_DOI 10.1016/j.str.2012.07.014 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Aragon, E.' 1 primary 'Goerner, N.' 2 primary 'Xi, Q.' 3 primary 'Gomes, T.' 4 primary 'Gao, S.' 5 primary 'Massague, J.' 6 primary 'Macias, M.J.' 7 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Yorkie homolog' 4151.594 1 ? ? 'WW1 domain (UNP residues 170-205)' ? 2 polymer syn 'Smad7 derived peptide' 1593.735 1 ? ? 'UNP residues 205-217' ? # _entity_name_com.entity_id 1 _entity_name_com.name '65 kDa Yes-associated protein, YAP65' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no DVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKA DVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKA A ? 2 'polypeptide(L)' no no GESPPPPYSRYPMD GESPPPPYSRYPMD B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 VAL n 1 3 PRO n 1 4 LEU n 1 5 PRO n 1 6 ALA n 1 7 GLY n 1 8 TRP n 1 9 GLU n 1 10 MET n 1 11 ALA n 1 12 LYS n 1 13 THR n 1 14 SER n 1 15 SER n 1 16 GLY n 1 17 GLN n 1 18 ARG n 1 19 TYR n 1 20 PHE n 1 21 LEU n 1 22 ASN n 1 23 HIS n 1 24 ILE n 1 25 ASP n 1 26 GLN n 1 27 THR n 1 28 THR n 1 29 THR n 1 30 TRP n 1 31 GLN n 1 32 ASP n 1 33 PRO n 1 34 ARG n 1 35 LYS n 1 36 ALA n 2 1 GLY n 2 2 GLU n 2 3 SER n 2 4 PRO n 2 5 PRO n 2 6 PRO n 2 7 PRO n 2 8 TYR n 2 9 SER n 2 10 ARG n 2 11 TYR n 2 12 PRO n 2 13 MET n 2 14 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'YAP1, YAP65' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name petM11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP YAP1_HUMAN P46937 1 DVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKA 170 ? 2 UNP SMAD7_HUMAN O15105 2 ESPPPPYSRYPMD 205 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LTW A 1 ? 36 ? P46937 170 ? 205 ? 170 205 2 2 2LTW B 2 ? 14 ? O15105 205 ? 217 ? 205 217 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 2LTW _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id B _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O15105 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'SEE REMARK 999' _struct_ref_seq_dif.pdbx_auth_seq_num 204 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '2D 1H-15N HSQC' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-1H NOESY' 1 4 2 '3D CBCA(CO)NH' 1 5 2 '3D HNCACB' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 285 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM YAPWW1, 2 mM SMAD7, 20 mM [U-100% 2H] TRIS, 100 mM sodium chloride, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 13C; U-100% 15N] YAPWW1, 3 mM SMAD7, 20 mM [U-100% 2H] TRIS, 100 mM sodium chloride, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LTW _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LTW _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LTW _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TOPSPIN ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Keller and Wuthrich' 'peak picking' CARA ? 3 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 4 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNSSOLVE ? 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNSSOLVE ? 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LTW _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LTW _struct.title 'YAP WW1 in complex with a Smad7 derived peptide' _struct.pdbx_descriptor 'Yorkie homolog, Smad7 derived peptide' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LTW _struct_keywords.pdbx_keywords 'PROTEIN BINDING/PEPTIDE' _struct_keywords.text 'WW, YAP, SMAD7, PROTEIN BINDING-PEPTIDE complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 8 ? THR A 13 ? TRP A 177 THR A 182 A 2 GLN A 17 ? ASN A 22 ? GLN A 186 ASN A 191 A 3 THR A 27 ? THR A 29 ? THR A 196 THR A 198 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 13 ? N THR A 182 O GLN A 17 ? O GLN A 186 A 2 3 N ASN A 22 ? N ASN A 191 O THR A 27 ? O THR A 196 # _atom_sites.entry_id 2LTW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 170 170 ASP ASP A . n A 1 2 VAL 2 171 171 VAL VAL A . n A 1 3 PRO 3 172 172 PRO PRO A . n A 1 4 LEU 4 173 173 LEU LEU A . n A 1 5 PRO 5 174 174 PRO PRO A . n A 1 6 ALA 6 175 175 ALA ALA A . n A 1 7 GLY 7 176 176 GLY GLY A . n A 1 8 TRP 8 177 177 TRP TRP A . n A 1 9 GLU 9 178 178 GLU GLU A . n A 1 10 MET 10 179 179 MET MET A . n A 1 11 ALA 11 180 180 ALA ALA A . n A 1 12 LYS 12 181 181 LYS LYS A . n A 1 13 THR 13 182 182 THR THR A . n A 1 14 SER 14 183 183 SER SER A . n A 1 15 SER 15 184 184 SER SER A . n A 1 16 GLY 16 185 185 GLY GLY A . n A 1 17 GLN 17 186 186 GLN GLN A . n A 1 18 ARG 18 187 187 ARG ARG A . n A 1 19 TYR 19 188 188 TYR TYR A . n A 1 20 PHE 20 189 189 PHE PHE A . n A 1 21 LEU 21 190 190 LEU LEU A . n A 1 22 ASN 22 191 191 ASN ASN A . n A 1 23 HIS 23 192 192 HIS HIS A . n A 1 24 ILE 24 193 193 ILE ILE A . n A 1 25 ASP 25 194 194 ASP ASP A . n A 1 26 GLN 26 195 195 GLN GLN A . n A 1 27 THR 27 196 196 THR THR A . n A 1 28 THR 28 197 197 THR THR A . n A 1 29 THR 29 198 198 THR THR A . n A 1 30 TRP 30 199 199 TRP TRP A . n A 1 31 GLN 31 200 200 GLN GLN A . n A 1 32 ASP 32 201 201 ASP ASP A . n A 1 33 PRO 33 202 202 PRO PRO A . n A 1 34 ARG 34 203 203 ARG ARG A . n A 1 35 LYS 35 204 204 LYS LYS A . n A 1 36 ALA 36 205 205 ALA ALA A . n B 2 1 GLY 1 204 204 GLY GLY B . n B 2 2 GLU 2 205 205 GLU GLU B . n B 2 3 SER 3 206 206 SER SER B . n B 2 4 PRO 4 207 207 PRO PRO B . n B 2 5 PRO 5 208 208 PRO PRO B . n B 2 6 PRO 6 209 209 PRO PRO B . n B 2 7 PRO 7 210 210 PRO PRO B . n B 2 8 TYR 8 211 211 TYR TYR B . n B 2 9 SER 9 212 212 SER SER B . n B 2 10 ARG 10 213 213 ARG ARG B . n B 2 11 TYR 11 214 214 TYR TYR B . n B 2 12 PRO 12 215 215 PRO PRO B . n B 2 13 MET 13 216 216 MET MET B . n B 2 14 ASP 14 217 217 ASP ASP B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2012-11-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_entry_details.entry_id 2LTW _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'THIS IS A SMAD7 DERIVED PEPTIDE.' _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id YAPWW1-1 1 ? mM ? 1 SMAD7-2 2 ? mM ? 1 TRIS-3 20 ? mM '[U-100% 2H]' 1 'sodium chloride-4' 100 ? mM ? 1 YAPWW1-5 1 ? mM '[U-100% 13C; U-100% 15N]' 2 SMAD7-6 3 ? mM ? 2 TRIS-7 20 ? mM '[U-100% 2H]' 2 'sodium chloride-8' 100 ? mM ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.32 2 2 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.31 3 3 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.31 4 3 HG3 B ARG 213 ? ? HD1 B TYR 214 ? ? 1.34 5 4 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.29 6 5 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.35 7 6 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.33 8 7 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.34 9 8 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.32 10 9 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.33 11 9 HH A TYR 188 ? ? HB2 B PRO 215 ? ? 1.34 12 10 HH A TYR 188 ? ? HB2 B PRO 215 ? ? 1.23 13 10 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.33 14 10 OE1 A GLU 178 ? ? HE2 A HIS 192 ? ? 1.59 15 11 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.33 16 12 HG1 A THR 182 ? ? HB2 A GLN 186 ? ? 1.30 17 12 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.31 18 13 HH A TYR 188 ? ? HB2 B PRO 215 ? ? 1.27 19 13 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.34 20 14 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.31 21 14 HH21 A ARG 187 ? ? OD2 A ASP 201 ? ? 1.59 22 15 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.32 23 16 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.31 24 17 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.33 25 17 HH A TYR 188 ? ? HB2 B PRO 215 ? ? 1.34 26 18 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.31 27 19 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.30 28 21 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.33 29 22 HH A TYR 188 ? ? HB2 B PRO 215 ? ? 1.20 30 22 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.31 31 23 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.31 32 24 HG1 A THR 182 ? ? HB2 A GLN 186 ? ? 1.18 33 24 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.31 34 25 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.33 35 26 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.34 36 26 HH21 A ARG 187 ? ? OD2 A ASP 201 ? ? 1.59 37 27 HH A TYR 188 ? ? HB2 B PRO 215 ? ? 1.20 38 27 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.31 39 28 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.35 40 29 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.30 41 30 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.32 42 30 HH A TYR 188 ? ? HB2 B PRO 215 ? ? 1.33 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG B 213 ? ? -120.28 -71.41 2 2 ARG B 213 ? ? -120.61 -70.81 3 3 GLN A 195 ? ? 72.74 30.94 4 3 ARG B 213 ? ? -120.46 -70.60 5 4 SER B 212 ? ? -59.21 -70.36 6 4 ARG B 213 ? ? -120.92 -71.33 7 4 PRO B 215 ? ? -60.47 -70.05 8 5 ARG A 203 ? ? -87.42 -70.66 9 5 ARG B 213 ? ? -120.49 -70.94 10 6 ARG B 213 ? ? -120.42 -70.98 11 7 ARG B 213 ? ? -120.42 -71.33 12 8 ARG B 213 ? ? -120.39 -71.07 13 9 ARG B 213 ? ? -120.26 -71.32 14 10 ARG B 213 ? ? -120.24 -70.81 15 11 LYS A 204 ? ? -98.43 -65.92 16 11 ARG B 213 ? ? -120.39 -70.89 17 11 PRO B 215 ? ? -60.48 -70.03 18 12 GLN A 195 ? ? 60.54 62.25 19 12 SER B 212 ? ? -58.99 -70.04 20 12 ARG B 213 ? ? -120.50 -70.92 21 12 PRO B 215 ? ? -60.84 -70.11 22 13 ARG B 213 ? ? -120.38 -70.90 23 14 GLN A 195 ? ? 60.52 67.55 24 14 LYS A 204 ? ? -100.00 -64.66 25 14 SER B 212 ? ? -59.27 -70.44 26 14 ARG B 213 ? ? -120.58 -71.00 27 15 SER B 212 ? ? -58.76 -70.28 28 15 ARG B 213 ? ? -120.61 -71.13 29 16 GLN A 195 ? ? 64.11 64.36 30 16 SER B 212 ? ? -59.27 -70.15 31 16 ARG B 213 ? ? -120.59 -70.75 32 16 PRO B 215 ? ? -65.44 -70.06 33 17 GLN A 195 ? ? 70.36 32.27 34 17 ARG B 213 ? ? -120.52 -70.71 35 18 ARG B 213 ? ? -120.56 -70.92 36 18 PRO B 215 ? ? -70.09 -70.10 37 19 ARG B 213 ? ? -120.44 -70.74 38 20 ARG B 213 ? ? -120.34 -70.99 39 21 ARG B 213 ? ? -120.30 -71.03 40 21 PRO B 215 ? ? -59.79 -70.25 41 22 GLN A 195 ? ? 65.66 66.23 42 22 ARG B 213 ? ? -120.33 -70.65 43 23 GLN A 195 ? ? 70.61 31.23 44 23 SER B 212 ? ? -59.12 -70.35 45 23 ARG B 213 ? ? -120.96 -71.24 46 23 PRO B 215 ? ? -70.28 -70.00 47 24 SER B 212 ? ? -58.86 -70.25 48 24 ARG B 213 ? ? -120.77 -71.15 49 25 SER B 212 ? ? -58.69 -70.09 50 25 ARG B 213 ? ? -120.47 -70.66 51 26 GLN A 195 ? ? 70.46 34.34 52 26 LYS A 204 ? ? -100.08 -75.00 53 26 ARG B 213 ? ? -120.60 -71.02 54 27 SER B 212 ? ? -59.21 -70.49 55 27 ARG B 213 ? ? -120.62 -70.92 56 28 ASP A 201 ? ? -53.66 109.48 57 28 SER B 212 ? ? -58.65 -70.29 58 28 ARG B 213 ? ? -120.69 -70.90 59 29 ARG B 213 ? ? -120.55 -71.02 60 30 GLN A 195 ? ? 62.38 62.33 61 30 LYS A 204 ? ? -59.88 -70.78 62 30 ARG B 213 ? ? -120.53 -71.01 #