data_2LUE # _entry.id 2LUE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LUE pdb_00002lue 10.2210/pdb2lue/pdb RCSB RCSB102845 ? ? BMRB 18518 ? 10.13018/BMR18518 WWPDB D_1000102845 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-07-17 2 'Structure model' 1 1 2022-08-24 3 'Structure model' 1 2 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' database_2 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_conn 6 2 'Structure model' struct_ref_seq_dif 7 3 'Structure model' chem_comp_atom 8 3 'Structure model' chem_comp_bond 9 3 'Structure model' database_2 10 3 'Structure model' pdbx_entry_details 11 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_database_2.pdbx_DOI' 5 2 'Structure model' '_database_2.pdbx_database_accession' 6 2 'Structure model' '_pdbx_nmr_software.name' 7 2 'Structure model' '_pdbx_nmr_spectrometer.model' 8 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 9 2 'Structure model' '_struct_ref_seq_dif.details' 10 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LUE _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2012-06-13 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 3VTU PDB 'Free LC3B crystall structure' unspecified 3VTV PDB 'OPTN LIR-LC3B crystall structure' unspecified 3VTW PDB 'T7 OPTN LIR-LC3B crystall structure' unspecified 18518 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rogov, V.V.' 1 'Rozenknop, A.' 2 'Loehr, F.' 3 'Guentert, P.' 4 'Doetsch, V.' 5 # _citation.id primary _citation.title 'Structural basis for phosphorylation-triggered autophagic clearance of Salmonella.' _citation.journal_abbrev Biochem.J. _citation.journal_volume 454 _citation.page_first 459 _citation.page_last 466 _citation.year 2013 _citation.journal_id_ASTM BIJOAK _citation.country UK _citation.journal_id_ISSN 1470-8728 _citation.journal_id_CSD 0043 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23805866 _citation.pdbx_database_id_DOI 10.1042/BJ20121907 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rogov, V.V.' 1 ? primary 'Suzuki, H.' 2 ? primary 'Fiskin, E.' 3 ? primary 'Wild, P.' 4 ? primary 'Kniss, A.' 5 ? primary 'Rozenknop, A.' 6 ? primary 'Kato, R.' 7 ? primary 'Kawasaki, M.' 8 ? primary 'McEwan, D.G.' 9 ? primary 'Lohr, F.' 10 ? primary 'Guntert, P.' 11 ? primary 'Dikic, I.' 12 ? primary 'Wakatsuki, S.' 13 ? primary 'Dotsch, V.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Microtubule-associated proteins 1A/1B light chain 3B' 13965.106 1 ? ? 'UNP RESIDUES 5-119' ? 2 polymer syn Optineurin 2245.813 1 ? ? 'UNP RESIDUES 169-185' ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ;Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, MAP1A/MAP1B LC3 B, Microtubule-associated protein 1 light chain 3 beta ; 2 ;E3-14.7K-interacting protein, FIP-2, Huntingtin yeast partner L, Huntingtin-interacting protein 7, HIP-7, Huntingtin-interacting protein L, NEMO-related protein, Optic neuropathy-inducing protein, Transcription factor IIIA-interacting protein, TFIIIA-IntP ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GAMGKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFF LLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF ; ;GAMGKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFF LLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF ; A ? 2 'polypeptide(L)' no yes 'N(SEP)(SEP)G(SEP)(SEP)ED(SEP)FVEIRMAE' NSSGSSEDSFVEIRMAE B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 LYS n 1 6 THR n 1 7 PHE n 1 8 LYS n 1 9 GLN n 1 10 ARG n 1 11 ARG n 1 12 THR n 1 13 PHE n 1 14 GLU n 1 15 GLN n 1 16 ARG n 1 17 VAL n 1 18 GLU n 1 19 ASP n 1 20 VAL n 1 21 ARG n 1 22 LEU n 1 23 ILE n 1 24 ARG n 1 25 GLU n 1 26 GLN n 1 27 HIS n 1 28 PRO n 1 29 THR n 1 30 LYS n 1 31 ILE n 1 32 PRO n 1 33 VAL n 1 34 ILE n 1 35 ILE n 1 36 GLU n 1 37 ARG n 1 38 TYR n 1 39 LYS n 1 40 GLY n 1 41 GLU n 1 42 LYS n 1 43 GLN n 1 44 LEU n 1 45 PRO n 1 46 VAL n 1 47 LEU n 1 48 ASP n 1 49 LYS n 1 50 THR n 1 51 LYS n 1 52 PHE n 1 53 LEU n 1 54 VAL n 1 55 PRO n 1 56 ASP n 1 57 HIS n 1 58 VAL n 1 59 ASN n 1 60 MET n 1 61 SER n 1 62 GLU n 1 63 LEU n 1 64 ILE n 1 65 LYS n 1 66 ILE n 1 67 ILE n 1 68 ARG n 1 69 ARG n 1 70 ARG n 1 71 LEU n 1 72 GLN n 1 73 LEU n 1 74 ASN n 1 75 ALA n 1 76 ASN n 1 77 GLN n 1 78 ALA n 1 79 PHE n 1 80 PHE n 1 81 LEU n 1 82 LEU n 1 83 VAL n 1 84 ASN n 1 85 GLY n 1 86 HIS n 1 87 SER n 1 88 MET n 1 89 VAL n 1 90 SER n 1 91 VAL n 1 92 SER n 1 93 THR n 1 94 PRO n 1 95 ILE n 1 96 SER n 1 97 GLU n 1 98 VAL n 1 99 TYR n 1 100 GLU n 1 101 SER n 1 102 GLU n 1 103 LYS n 1 104 ASP n 1 105 GLU n 1 106 ASP n 1 107 GLY n 1 108 PHE n 1 109 LEU n 1 110 TYR n 1 111 MET n 1 112 VAL n 1 113 TYR n 1 114 ALA n 1 115 SER n 1 116 GLN n 1 117 GLU n 1 118 THR n 1 119 PHE n 2 1 ASN n 2 2 SEP n 2 3 SEP n 2 4 GLY n 2 5 SEP n 2 6 SEP n 2 7 GLU n 2 8 ASP n 2 9 SEP n 2 10 PHE n 2 11 VAL n 2 12 GLU n 2 13 ILE n 2 14 ARG n 2 15 MET n 2 16 ALA n 2 17 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MAP1LC3B, MAP1ALC3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'NEB T7 Express' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pETm60_UB3 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details 'The peptide was chemically synthesized.' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 PHE 119 119 119 PHE PHE A . n B 2 1 ASN 1 169 169 ASN ASN B . n B 2 2 SEP 2 170 170 SEP SEP B . n B 2 3 SEP 3 171 171 SEP SEP B . n B 2 4 GLY 4 172 172 GLY GLY B . n B 2 5 SEP 5 173 173 SEP SEP B . n B 2 6 SEP 6 174 174 SEP SEP B . n B 2 7 GLU 7 175 175 GLU GLU B . n B 2 8 ASP 8 176 176 ASP ASP B . n B 2 9 SEP 9 177 177 SEP SEP B . n B 2 10 PHE 10 178 178 PHE PHE B . n B 2 11 VAL 11 179 179 VAL VAL B . n B 2 12 GLU 12 180 180 GLU GLU B . n B 2 13 ILE 13 181 181 ILE ILE B . n B 2 14 ARG 14 182 182 ARG ARG B . n B 2 15 MET 15 183 183 MET MET B . n B 2 16 ALA 16 184 184 ALA ALA B . n B 2 17 GLU 17 185 185 GLU GLU B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;Complex structure of the autophagy modifier LC3B with synthetic OPTN-LIR peptide in totally phosphorylated form (all five serines are phosphoserines) ; _exptl.entry_id 2LUE _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LUE _struct.title 'LC3B OPTN-LIR Ptot complex structure' _struct.pdbx_model_details 'closest to the average, model2' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LUE _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'Selective autophagy, LC3 proteins, Signaling protein, Protein-peptide complex, Phosphoserine, PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP MLP3B_HUMAN Q9GZQ8 1 ;KTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVN GHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF ; 5 ? 2 UNP OPTN_HUMAN Q96CV9 2 NSSGSSEDSFVEIRMAE 169 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LUE A 5 ? 119 ? Q9GZQ8 5 ? 119 ? 5 119 2 2 2LUE B 1 ? 17 ? Q96CV9 169 ? 185 ? 169 185 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LUE GLY A 1 ? UNP Q9GZQ8 ? ? 'expression tag' 1 1 1 2LUE ALA A 2 ? UNP Q9GZQ8 ? ? 'expression tag' 2 2 1 2LUE MET A 3 ? UNP Q9GZQ8 ? ? 'expression tag' 3 3 1 2LUE GLY A 4 ? UNP Q9GZQ8 ? ? 'expression tag' 4 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 6 ? ARG A 11 ? THR A 6 ARG A 11 1 ? 6 HELX_P HELX_P2 2 THR A 12 ? HIS A 27 ? THR A 12 HIS A 27 1 ? 16 HELX_P HELX_P3 3 ASN A 59 ? GLN A 72 ? ASN A 59 GLN A 72 1 ? 14 HELX_P HELX_P4 4 PRO A 94 ? LYS A 103 ? PRO A 94 LYS A 103 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ASN 1 C ? ? ? 1_555 B SEP 2 N ? ? B ASN 169 B SEP 170 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale2 covale both ? B SEP 2 C ? ? ? 1_555 B SEP 3 N ? ? B SEP 170 B SEP 171 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale3 covale both ? B SEP 3 C ? ? ? 1_555 B GLY 4 N ? ? B SEP 171 B GLY 172 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale4 covale both ? B GLY 4 C ? ? ? 1_555 B SEP 5 N ? ? B GLY 172 B SEP 173 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale5 covale both ? B SEP 5 C ? ? ? 1_555 B SEP 6 N ? ? B SEP 173 B SEP 174 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale6 covale both ? B SEP 6 C ? ? ? 1_555 B GLU 7 N ? ? B SEP 174 B GLU 175 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale7 covale both ? B ASP 8 C ? ? ? 1_555 B SEP 9 N ? ? B ASP 176 B SEP 177 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale8 covale both ? B SEP 9 C ? ? ? 1_555 B PHE 10 N ? ? B SEP 177 B PHE 178 1_555 ? ? ? ? ? ? ? 1.333 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 SEP B 2 ? . . . . SEP B 170 ? 1_555 . . . . . . . SER 1 SEP Phosphorylation 'Named protein modification' 2 SEP B 3 ? . . . . SEP B 171 ? 1_555 . . . . . . . SER 1 SEP Phosphorylation 'Named protein modification' 3 SEP B 5 ? . . . . SEP B 173 ? 1_555 . . . . . . . SER 1 SEP Phosphorylation 'Named protein modification' 4 SEP B 6 ? . . . . SEP B 174 ? 1_555 . . . . . . . SER 1 SEP Phosphorylation 'Named protein modification' 5 SEP B 9 ? . . . . SEP B 177 ? 1_555 . . . . . . . SER 1 SEP Phosphorylation 'Named protein modification' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 80 ? VAL A 83 ? PHE A 80 VAL A 83 A 2 LEU A 109 ? ALA A 114 ? LEU A 109 ALA A 114 A 3 LYS A 30 ? ARG A 37 ? LYS A 30 ARG A 37 A 4 LYS A 51 ? PRO A 55 ? LYS A 51 PRO A 55 A 5 PHE B 10 ? GLU B 12 ? PHE B 178 GLU B 180 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 82 ? N LEU A 82 O VAL A 112 ? O VAL A 112 A 2 3 O LEU A 109 ? O LEU A 109 N ILE A 34 ? N ILE A 34 A 3 4 N VAL A 33 ? N VAL A 33 O PHE A 52 ? O PHE A 52 A 4 5 N LYS A 51 ? N LYS A 51 O VAL B 11 ? O VAL B 179 # _pdbx_entry_details.entry_id 2LUE _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 5 _pdbx_validate_close_contact.auth_atom_id_1 HG1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 THR _pdbx_validate_close_contact.auth_seq_id_1 6 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 36 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 12 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 117.16 120.30 -3.14 0.50 N 2 15 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 117.24 120.30 -3.06 0.50 N 3 20 CB A TYR 110 ? ? CG A TYR 110 ? ? CD2 A TYR 110 ? ? 117.17 121.00 -3.83 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 3 ? ? -161.25 106.24 2 1 ASN A 84 ? ? 60.89 -2.46 3 1 SER A 115 ? ? -104.54 77.75 4 1 GLN A 116 ? ? -178.12 143.27 5 2 ALA A 2 ? ? -59.71 98.38 6 2 THR A 12 ? ? -59.31 170.05 7 2 ASN A 84 ? ? 59.29 14.13 8 2 GLN A 116 ? ? -172.69 132.51 9 3 LYS A 42 ? ? -143.44 -24.51 10 3 ASN A 74 ? ? -45.24 160.19 11 3 ASN A 84 ? ? 66.28 -9.75 12 3 SER A 115 ? ? -108.24 77.68 13 3 SEP B 177 ? ? -106.27 -162.38 14 4 MET A 3 ? ? -175.31 96.03 15 4 ASN A 84 ? ? 53.69 14.81 16 4 SER A 115 ? ? -103.62 77.77 17 4 GLN A 116 ? ? 179.16 149.09 18 4 SEP B 177 ? ? -114.36 -82.62 19 5 ASN A 84 ? ? 57.47 14.89 20 5 SER A 115 ? ? -110.57 76.10 21 5 GLN A 116 ? ? -174.04 132.22 22 5 SEP B 177 ? ? -140.09 -84.39 23 6 LYS A 42 ? ? -137.00 -40.97 24 6 THR A 50 ? ? -130.87 -60.64 25 6 ASN A 84 ? ? 61.16 -4.44 26 6 SER A 115 ? ? -104.72 76.76 27 6 GLN A 116 ? ? 179.89 134.56 28 6 MET B 183 ? ? -67.23 -171.83 29 7 LYS A 42 ? ? -142.17 -12.24 30 7 ASN A 84 ? ? 56.61 9.85 31 7 SER A 115 ? ? -103.68 76.69 32 7 GLN A 116 ? ? -177.67 146.08 33 7 SEP B 170 ? ? -131.55 -47.30 34 7 SEP B 177 ? ? -137.79 -57.25 35 8 LYS A 42 ? ? -141.37 -12.45 36 8 ASN A 84 ? ? 65.09 -8.81 37 8 SER A 115 ? ? -110.32 77.33 38 8 GLN A 116 ? ? -171.99 131.56 39 8 SEP B 170 ? ? -71.19 42.41 40 8 SEP B 177 ? ? -144.52 -54.35 41 9 LYS A 42 ? ? -140.42 -42.93 42 9 ASN A 84 ? ? 59.88 11.06 43 9 SEP B 170 ? ? -92.10 48.62 44 9 SEP B 174 ? ? -113.67 -76.62 45 9 SEP B 177 ? ? -143.82 -32.51 46 10 THR A 50 ? ? -133.63 -50.78 47 10 ASP B 176 ? ? -144.06 52.42 48 10 SEP B 177 ? ? -129.38 -83.53 49 10 MET B 183 ? ? -172.19 -170.47 50 11 ASN A 84 ? ? 51.57 16.28 51 11 SER A 115 ? ? -111.97 77.25 52 11 GLN A 116 ? ? 177.25 137.84 53 12 LYS A 42 ? ? -140.54 -19.21 54 12 ASN A 84 ? ? 62.81 -1.56 55 12 SER A 115 ? ? -106.74 78.22 56 12 GLN A 116 ? ? 179.51 138.73 57 13 LYS A 42 ? ? -146.70 -32.21 58 13 ASN A 84 ? ? 59.82 3.50 59 13 SER A 115 ? ? -106.74 76.22 60 13 GLN A 116 ? ? -173.82 132.15 61 13 SEP B 174 ? ? -152.88 -71.00 62 13 MET B 183 ? ? -155.35 -154.00 63 14 ASN A 84 ? ? 58.69 4.25 64 14 GLN A 116 ? ? -171.47 131.41 65 14 ASP B 176 ? ? -58.35 109.92 66 14 SEP B 177 ? ? -123.83 -62.54 67 15 ASN A 84 ? ? 59.16 3.70 68 15 GLN A 116 ? ? -177.48 134.62 69 15 SEP B 170 ? ? -63.13 -73.44 70 15 SEP B 173 ? ? -151.94 60.44 71 15 SEP B 174 ? ? -143.41 -64.86 72 15 SEP B 177 ? ? -104.69 -73.55 73 15 MET B 183 ? ? -156.17 82.98 74 16 ASN A 84 ? ? 66.06 -7.39 75 16 GLN A 116 ? ? 175.41 132.43 76 16 SEP B 171 ? ? -106.80 -169.71 77 16 ASP B 176 ? ? -53.16 86.18 78 17 ALA A 2 ? ? -136.32 -154.35 79 17 ASN A 84 ? ? 62.86 -1.67 80 17 GLN A 116 ? ? -171.42 145.19 81 18 ASN A 84 ? ? 57.56 17.91 82 18 SER A 115 ? ? -106.34 76.94 83 18 GLN A 116 ? ? -171.31 132.12 84 18 SEP B 177 ? ? -139.12 -72.41 85 19 HIS A 27 ? ? -119.34 74.01 86 19 THR A 50 ? ? -124.61 -51.13 87 19 ASN A 84 ? ? 54.37 18.29 88 19 GLN A 116 ? ? -177.64 140.36 89 19 SEP B 170 ? ? -128.54 -67.76 90 19 MET B 183 ? ? -177.80 -162.95 91 20 LYS A 42 ? ? -151.28 -22.42 92 20 ASN A 84 ? ? 54.83 14.45 93 20 SER A 115 ? ? -104.59 77.50 94 20 SEP B 170 ? ? -72.50 25.21 95 20 GLU B 175 ? ? -130.06 -99.77 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 ARG A 37 ? ? 0.087 'SIDE CHAIN' 2 2 TYR A 110 ? ? 0.084 'SIDE CHAIN' 3 2 TYR A 113 ? ? 0.064 'SIDE CHAIN' 4 3 ARG A 16 ? ? 0.083 'SIDE CHAIN' 5 3 TYR A 99 ? ? 0.083 'SIDE CHAIN' 6 4 ARG A 21 ? ? 0.099 'SIDE CHAIN' 7 4 TYR A 99 ? ? 0.079 'SIDE CHAIN' 8 5 TYR A 99 ? ? 0.089 'SIDE CHAIN' 9 5 ARG B 182 ? ? 0.089 'SIDE CHAIN' 10 7 TYR A 113 ? ? 0.081 'SIDE CHAIN' 11 8 ARG A 21 ? ? 0.156 'SIDE CHAIN' 12 8 ARG A 68 ? ? 0.078 'SIDE CHAIN' 13 9 ARG A 37 ? ? 0.095 'SIDE CHAIN' 14 9 TYR A 113 ? ? 0.118 'SIDE CHAIN' 15 10 ARG A 21 ? ? 0.101 'SIDE CHAIN' 16 10 ARG B 182 ? ? 0.090 'SIDE CHAIN' 17 11 ARG A 37 ? ? 0.111 'SIDE CHAIN' 18 12 ARG A 16 ? ? 0.090 'SIDE CHAIN' 19 13 TYR A 110 ? ? 0.078 'SIDE CHAIN' 20 15 ARG A 21 ? ? 0.086 'SIDE CHAIN' 21 15 ARG A 69 ? ? 0.124 'SIDE CHAIN' 22 17 ARG A 21 ? ? 0.097 'SIDE CHAIN' 23 19 ARG A 21 ? ? 0.107 'SIDE CHAIN' 24 19 TYR A 110 ? ? 0.068 'SIDE CHAIN' 25 20 ARG A 21 ? ? 0.083 'SIDE CHAIN' 26 20 ARG A 68 ? ? 0.094 'SIDE CHAIN' 27 20 ARG A 70 ? ? 0.079 'SIDE CHAIN' 28 20 ARG B 182 ? ? 0.081 'SIDE CHAIN' # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 8 SEP B 173 ? ? 11.79 2 14 SEP B 174 ? ? 14.72 3 20 SEP B 170 ? ? 11.48 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 B SEP 2 B SEP 170 ? SER PHOSPHOSERINE 2 B SEP 3 B SEP 171 ? SER PHOSPHOSERINE 3 B SEP 5 B SEP 173 ? SER PHOSPHOSERINE 4 B SEP 6 B SEP 174 ? SER PHOSPHOSERINE 5 B SEP 9 B SEP 177 ? SER PHOSPHOSERINE # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LUE _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.1 _pdbx_nmr_ensemble.representative_conformer 2 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LUE _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.6 mM [U-98% 13C; U-98% 15N] entity_1-1, 4.9 mM entity_2-2, 70 mM sodium phosphate-3, 30 mM sodium chloride-4, 0.3 mM DSS-5, 5 mM Protease inhibitors cocktail-6, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;2.5 mM [U-98% 13C; U-98% 15N] entity_1-7, 0.4 mM entity_2-8, 70 mM sodium phosphate-9, 30 mM sodium chloride-10, 0.3 mM DSS-11, 5 mM Protease inhibitors cocktail-12, 95% H2O/5% D2O ; 2 '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity_1-1 0.6 ? mM '[U-98% 13C; U-98% 15N]' 1 entity_2-2 4.9 ? mM ? 1 'sodium phosphate-3' 70 ? mM ? 1 'sodium chloride-4' 30 ? mM ? 1 DSS-5 0.3 ? mM ? 1 'Protease inhibitors cocktail-6' 5 ? mM ? 1 entity_1-7 2.5 ? mM '[U-98% 13C; U-98% 15N]' 2 entity_2-8 0.4 ? mM ? 2 'sodium phosphate-9' 70 ? mM ? 2 'sodium chloride-10' 30 ? mM ? 2 DSS-11 0.3 ? mM ? 2 'Protease inhibitors cocktail-12' 5 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.05 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 1 '3D HNCACB' 1 5 1 '3D HNCO' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY aliphatic' 1 9 1 '3D 1H-13C NOESY aromatic' 1 10 1 '3D NOESY-[13C,1H]-HSQC 13C/15N filtered in F1' 1 11 2 '2D 1H-1H NOESY F1,F2 13C/15N filtered' 1 12 1 '3D NOESY-[15N,1H]-FHSQC' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LUE _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 94 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 3472 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 750 _pdbx_nmr_constraints.NOE_long_range_total_count 1240 _pdbx_nmr_constraints.NOE_medium_range_total_count 715 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 767 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 126 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 130 # _pdbx_nmr_refine.entry_id 2LUE _pdbx_nmr_refine.method 'restrained energy refinement' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Bruker Biospin' collection TopSpin 1 2 'Bruker Biospin' 'chemical shift calculation' TopSpin 2 2 'Bruker Biospin' processing TopSpin 3 2 Goddard 'data analysis' Sparky 4 3.114 Goddard 'chemical shift assignment' Sparky 5 3.114 Goddard 'peak picking' Sparky 6 3.114 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 7 2 'Koradi, Billeter and Guntert' refinement OPALp 8 ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SEP N N N N 273 SEP CA C N S 274 SEP CB C N N 275 SEP OG O N N 276 SEP C C N N 277 SEP O O N N 278 SEP OXT O N N 279 SEP P P N N 280 SEP O1P O N N 281 SEP O2P O N N 282 SEP O3P O N N 283 SEP H H N N 284 SEP H2 H N N 285 SEP HA H N N 286 SEP HB2 H N N 287 SEP HB3 H N N 288 SEP HXT H N N 289 SEP HOP2 H N N 290 SEP HOP3 H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TYR N N N N 323 TYR CA C N S 324 TYR C C N N 325 TYR O O N N 326 TYR CB C N N 327 TYR CG C Y N 328 TYR CD1 C Y N 329 TYR CD2 C Y N 330 TYR CE1 C Y N 331 TYR CE2 C Y N 332 TYR CZ C Y N 333 TYR OH O N N 334 TYR OXT O N N 335 TYR H H N N 336 TYR H2 H N N 337 TYR HA H N N 338 TYR HB2 H N N 339 TYR HB3 H N N 340 TYR HD1 H N N 341 TYR HD2 H N N 342 TYR HE1 H N N 343 TYR HE2 H N N 344 TYR HH H N N 345 TYR HXT H N N 346 VAL N N N N 347 VAL CA C N S 348 VAL C C N N 349 VAL O O N N 350 VAL CB C N N 351 VAL CG1 C N N 352 VAL CG2 C N N 353 VAL OXT O N N 354 VAL H H N N 355 VAL H2 H N N 356 VAL HA H N N 357 VAL HB H N N 358 VAL HG11 H N N 359 VAL HG12 H N N 360 VAL HG13 H N N 361 VAL HG21 H N N 362 VAL HG22 H N N 363 VAL HG23 H N N 364 VAL HXT H N N 365 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SEP N CA sing N N 262 SEP N H sing N N 263 SEP N H2 sing N N 264 SEP CA CB sing N N 265 SEP CA C sing N N 266 SEP CA HA sing N N 267 SEP CB OG sing N N 268 SEP CB HB2 sing N N 269 SEP CB HB3 sing N N 270 SEP OG P sing N N 271 SEP C O doub N N 272 SEP C OXT sing N N 273 SEP OXT HXT sing N N 274 SEP P O1P doub N N 275 SEP P O2P sing N N 276 SEP P O3P sing N N 277 SEP O2P HOP2 sing N N 278 SEP O3P HOP3 sing N N 279 SER N CA sing N N 280 SER N H sing N N 281 SER N H2 sing N N 282 SER CA C sing N N 283 SER CA CB sing N N 284 SER CA HA sing N N 285 SER C O doub N N 286 SER C OXT sing N N 287 SER CB OG sing N N 288 SER CB HB2 sing N N 289 SER CB HB3 sing N N 290 SER OG HG sing N N 291 SER OXT HXT sing N N 292 THR N CA sing N N 293 THR N H sing N N 294 THR N H2 sing N N 295 THR CA C sing N N 296 THR CA CB sing N N 297 THR CA HA sing N N 298 THR C O doub N N 299 THR C OXT sing N N 300 THR CB OG1 sing N N 301 THR CB CG2 sing N N 302 THR CB HB sing N N 303 THR OG1 HG1 sing N N 304 THR CG2 HG21 sing N N 305 THR CG2 HG22 sing N N 306 THR CG2 HG23 sing N N 307 THR OXT HXT sing N N 308 TYR N CA sing N N 309 TYR N H sing N N 310 TYR N H2 sing N N 311 TYR CA C sing N N 312 TYR CA CB sing N N 313 TYR CA HA sing N N 314 TYR C O doub N N 315 TYR C OXT sing N N 316 TYR CB CG sing N N 317 TYR CB HB2 sing N N 318 TYR CB HB3 sing N N 319 TYR CG CD1 doub Y N 320 TYR CG CD2 sing Y N 321 TYR CD1 CE1 sing Y N 322 TYR CD1 HD1 sing N N 323 TYR CD2 CE2 doub Y N 324 TYR CD2 HD2 sing N N 325 TYR CE1 CZ doub Y N 326 TYR CE1 HE1 sing N N 327 TYR CE2 CZ sing Y N 328 TYR CE2 HE2 sing N N 329 TYR CZ OH sing N N 330 TYR OH HH sing N N 331 TYR OXT HXT sing N N 332 VAL N CA sing N N 333 VAL N H sing N N 334 VAL N H2 sing N N 335 VAL CA C sing N N 336 VAL CA CB sing N N 337 VAL CA HA sing N N 338 VAL C O doub N N 339 VAL C OXT sing N N 340 VAL CB CG1 sing N N 341 VAL CB CG2 sing N N 342 VAL CB HB sing N N 343 VAL CG1 HG11 sing N N 344 VAL CG1 HG12 sing N N 345 VAL CG1 HG13 sing N N 346 VAL CG2 HG21 sing N N 347 VAL CG2 HG22 sing N N 348 VAL CG2 HG23 sing N N 349 VAL OXT HXT sing N N 350 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 900 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' 700 Bruker AVANCE 3 'Bruker Avance' 600 Bruker AVANCE 4 'Bruker Avance' 500 Bruker AVANCE 5 'Bruker Avance' # _atom_sites.entry_id 2LUE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ #