data_2LV9 # _entry.id 2LV9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LV9 RCSB RCSB102876 BMRB 18559 WWPDB D_1000102876 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18559 BMRB unspecified . NESG-HR6512A TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LV9 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-06-29 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category CASP _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lemak, A.' 1 'Yee, A.' 2 'Houliston, S.' 3 'Garcia, M.' 4 'Wu, H.' 5 'Min, J.' 6 'Montelione, G.T.' 7 'Arrowsmith, C.' 8 'Northeast Structural Genomics Consortium (NESG)' 9 'Structural Genomics Consortium (SGC)' 10 'Chaperone-Enabled Studies of Epigenetic Regulation Enzymes (CEBS)' 11 # _citation.id primary _citation.title 'NMR solution structure of the human MLL5 PHD domain (CASP Target)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lemak, A.' 1 primary 'Yee, A.' 2 primary 'Houliston, S.' 3 primary 'Garcia, M.' 4 primary 'Wu, H.' 5 primary 'Min, J.' 6 primary 'Montelione, G.T.' 7 primary 'Arrowsmith, C.' 8 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histone-lysine N-methyltransferase MLL5' 11518.857 1 2.1.1.43 ? 'PHD-type domain residues 109-188' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Lysine N-methyltransferase 2E, KMT2E, Myeloid/lymphoid or mixed-lineage leukemia protein 5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGRENLYFQGSEDGSYGTDVTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDK ERAVLLQRRKRENMSDGD ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGRENLYFQGSEDGSYGTDVTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDK ERAVLLQRRKRENMSDGD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-HR6512A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 ARG n 1 12 GLU n 1 13 ASN n 1 14 LEU n 1 15 TYR n 1 16 PHE n 1 17 GLN n 1 18 GLY n 1 19 SER n 1 20 GLU n 1 21 ASP n 1 22 GLY n 1 23 SER n 1 24 TYR n 1 25 GLY n 1 26 THR n 1 27 ASP n 1 28 VAL n 1 29 THR n 1 30 ARG n 1 31 CYS n 1 32 ILE n 1 33 CYS n 1 34 GLY n 1 35 PHE n 1 36 THR n 1 37 HIS n 1 38 ASP n 1 39 ASP n 1 40 GLY n 1 41 TYR n 1 42 MET n 1 43 ILE n 1 44 CYS n 1 45 CYS n 1 46 ASP n 1 47 LYS n 1 48 CYS n 1 49 SER n 1 50 VAL n 1 51 TRP n 1 52 GLN n 1 53 HIS n 1 54 ILE n 1 55 ASP n 1 56 CYS n 1 57 MET n 1 58 GLY n 1 59 ILE n 1 60 ASP n 1 61 ARG n 1 62 GLN n 1 63 HIS n 1 64 ILE n 1 65 PRO n 1 66 ASP n 1 67 THR n 1 68 TYR n 1 69 LEU n 1 70 CYS n 1 71 GLU n 1 72 ARG n 1 73 CYS n 1 74 GLN n 1 75 PRO n 1 76 ARG n 1 77 ASN n 1 78 LEU n 1 79 ASP n 1 80 LYS n 1 81 GLU n 1 82 ARG n 1 83 ALA n 1 84 VAL n 1 85 LEU n 1 86 LEU n 1 87 GLN n 1 88 ARG n 1 89 ARG n 1 90 LYS n 1 91 ARG n 1 92 GLU n 1 93 ASN n 1 94 MET n 1 95 SER n 1 96 ASP n 1 97 GLY n 1 98 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MLL5, KMT2E' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET28b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MLL5_HUMAN _struct_ref.pdbx_db_accession Q8IZD2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SEDGSYGTDVTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRKRENMSDGD ; _struct_ref.pdbx_align_begin 109 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LV9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 19 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 98 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8IZD2 _struct_ref_seq.db_align_beg 109 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 188 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 109 _struct_ref_seq.pdbx_auth_seq_align_end 188 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LV9 MET A 1 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 91 1 1 2LV9 HIS A 2 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 92 2 1 2LV9 HIS A 3 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 93 3 1 2LV9 HIS A 4 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 94 4 1 2LV9 HIS A 5 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 95 5 1 2LV9 HIS A 6 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 96 6 1 2LV9 HIS A 7 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 97 7 1 2LV9 SER A 8 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 98 8 1 2LV9 SER A 9 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 99 9 1 2LV9 GLY A 10 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 100 10 1 2LV9 ARG A 11 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 101 11 1 2LV9 GLU A 12 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 102 12 1 2LV9 ASN A 13 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 103 13 1 2LV9 LEU A 14 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 104 14 1 2LV9 TYR A 15 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 105 15 1 2LV9 PHE A 16 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 106 16 1 2LV9 GLN A 17 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 107 17 1 2LV9 GLY A 18 ? UNP Q8IZD2 ? ? 'EXPRESSION TAG' 108 18 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCO' 1 2 1 '3D HNCA' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HBHA(CO)NH' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY aliphatic' 1 9 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 300 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.5 mM [U-13C; U-15N] protein, 10 mM TRIS, 300 mM sodium chloride, 10 uM ZnSO4, 1 mM DTT, 0.01 % NaN3, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker Avance 1 'Bruker Avance' 800 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LV9 _pdbx_nmr_refine.method 'restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LV9 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LV9 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 Goddard 'peak picking' SPARKY ? 2 'Lemak,Steren,Llinas, Arrowsmith' 'chemical shift assignment' FMC ? 3 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 4 'Bhattacharya and Montelione' validation PSVS ? 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 6 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LV9 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LV9 _struct.title 'Solution NMR structure of the PHD domain of human MLL5, Northeast structural genomics consortium target HR6512A' _struct.pdbx_descriptor 'Histone-lysine N-methyltransferase MLL5 (E.C.2.1.1.43)' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LV9 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;Zinc Finger, transcription, protein binding, NESG, Northeast structural genomics consortium, SGC, Structural Genomics Consortium, PSI-Biology, TRANSFERASE, Chaperone-Enabled Studies of Epigenetic Regulation Enzymes, CEBS ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 79 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id MET _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 94 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 169 _struct_conf.end_auth_comp_id MET _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 184 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A HIS 53 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 143 A ZN 201 1_555 ? ? ? ? ? ? ? 2.093 ? metalc2 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 121 A ZN 201 1_555 ? ? ? ? ? ? ? 2.311 ? metalc3 metalc ? ? A CYS 45 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 135 A ZN 202 1_555 ? ? ? ? ? ? ? 2.335 ? metalc4 metalc ? ? A CYS 48 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 138 A ZN 202 1_555 ? ? ? ? ? ? ? 2.345 ? metalc5 metalc ? ? A CYS 56 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 146 A ZN 201 1_555 ? ? ? ? ? ? ? 2.345 ? metalc6 metalc ? ? A CYS 33 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 123 A ZN 201 1_555 ? ? ? ? ? ? ? 2.349 ? metalc7 metalc ? ? A CYS 73 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 163 A ZN 202 1_555 ? ? ? ? ? ? ? 2.350 ? metalc8 metalc ? ? A CYS 70 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 160 A ZN 202 1_555 ? ? ? ? ? ? ? 2.362 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 42 ? CYS A 44 ? MET A 132 CYS A 134 A 2 TRP A 51 ? HIS A 53 ? TRP A 141 HIS A 143 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 43 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 133 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 52 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 142 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 31 ? CYS A 121 . ? 1_555 ? 2 AC1 5 CYS A 33 ? CYS A 123 . ? 1_555 ? 3 AC1 5 HIS A 53 ? HIS A 143 . ? 1_555 ? 4 AC1 5 CYS A 56 ? CYS A 146 . ? 1_555 ? 5 AC1 5 GLN A 87 ? GLN A 177 . ? 1_555 ? 6 AC2 4 CYS A 45 ? CYS A 135 . ? 1_555 ? 7 AC2 4 CYS A 48 ? CYS A 138 . ? 1_555 ? 8 AC2 4 CYS A 70 ? CYS A 160 . ? 1_555 ? 9 AC2 4 CYS A 73 ? CYS A 163 . ? 1_555 ? # _atom_sites.entry_id 2LV9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 91 ? ? ? A . n A 1 2 HIS 2 92 ? ? ? A . n A 1 3 HIS 3 93 ? ? ? A . n A 1 4 HIS 4 94 ? ? ? A . n A 1 5 HIS 5 95 ? ? ? A . n A 1 6 HIS 6 96 ? ? ? A . n A 1 7 HIS 7 97 ? ? ? A . n A 1 8 SER 8 98 ? ? ? A . n A 1 9 SER 9 99 ? ? ? A . n A 1 10 GLY 10 100 ? ? ? A . n A 1 11 ARG 11 101 ? ? ? A . n A 1 12 GLU 12 102 ? ? ? A . n A 1 13 ASN 13 103 ? ? ? A . n A 1 14 LEU 14 104 ? ? ? A . n A 1 15 TYR 15 105 ? ? ? A . n A 1 16 PHE 16 106 ? ? ? A . n A 1 17 GLN 17 107 ? ? ? A . n A 1 18 GLY 18 108 ? ? ? A . n A 1 19 SER 19 109 109 SER SER A . n A 1 20 GLU 20 110 110 GLU GLU A . n A 1 21 ASP 21 111 111 ASP ASP A . n A 1 22 GLY 22 112 112 GLY GLY A . n A 1 23 SER 23 113 113 SER SER A . n A 1 24 TYR 24 114 114 TYR TYR A . n A 1 25 GLY 25 115 115 GLY GLY A . n A 1 26 THR 26 116 116 THR THR A . n A 1 27 ASP 27 117 117 ASP ASP A . n A 1 28 VAL 28 118 118 VAL VAL A . n A 1 29 THR 29 119 119 THR THR A . n A 1 30 ARG 30 120 120 ARG ARG A . n A 1 31 CYS 31 121 121 CYS CYS A . n A 1 32 ILE 32 122 122 ILE ILE A . n A 1 33 CYS 33 123 123 CYS CYS A . n A 1 34 GLY 34 124 124 GLY GLY A . n A 1 35 PHE 35 125 125 PHE PHE A . n A 1 36 THR 36 126 126 THR THR A . n A 1 37 HIS 37 127 127 HIS HIS A . n A 1 38 ASP 38 128 128 ASP ASP A . n A 1 39 ASP 39 129 129 ASP ASP A . n A 1 40 GLY 40 130 130 GLY GLY A . n A 1 41 TYR 41 131 131 TYR TYR A . n A 1 42 MET 42 132 132 MET MET A . n A 1 43 ILE 43 133 133 ILE ILE A . n A 1 44 CYS 44 134 134 CYS CYS A . n A 1 45 CYS 45 135 135 CYS CYS A . n A 1 46 ASP 46 136 136 ASP ASP A . n A 1 47 LYS 47 137 137 LYS LYS A . n A 1 48 CYS 48 138 138 CYS CYS A . n A 1 49 SER 49 139 139 SER SER A . n A 1 50 VAL 50 140 140 VAL VAL A . n A 1 51 TRP 51 141 141 TRP TRP A . n A 1 52 GLN 52 142 142 GLN GLN A . n A 1 53 HIS 53 143 143 HIS HIS A . n A 1 54 ILE 54 144 144 ILE ILE A . n A 1 55 ASP 55 145 145 ASP ASP A . n A 1 56 CYS 56 146 146 CYS CYS A . n A 1 57 MET 57 147 147 MET MET A . n A 1 58 GLY 58 148 148 GLY GLY A . n A 1 59 ILE 59 149 149 ILE ILE A . n A 1 60 ASP 60 150 150 ASP ASP A . n A 1 61 ARG 61 151 151 ARG ARG A . n A 1 62 GLN 62 152 152 GLN GLN A . n A 1 63 HIS 63 153 153 HIS HIS A . n A 1 64 ILE 64 154 154 ILE ILE A . n A 1 65 PRO 65 155 155 PRO PRO A . n A 1 66 ASP 66 156 156 ASP ASP A . n A 1 67 THR 67 157 157 THR THR A . n A 1 68 TYR 68 158 158 TYR TYR A . n A 1 69 LEU 69 159 159 LEU LEU A . n A 1 70 CYS 70 160 160 CYS CYS A . n A 1 71 GLU 71 161 161 GLU GLU A . n A 1 72 ARG 72 162 162 ARG ARG A . n A 1 73 CYS 73 163 163 CYS CYS A . n A 1 74 GLN 74 164 164 GLN GLN A . n A 1 75 PRO 75 165 165 PRO PRO A . n A 1 76 ARG 76 166 166 ARG ARG A . n A 1 77 ASN 77 167 167 ASN ASN A . n A 1 78 LEU 78 168 168 LEU LEU A . n A 1 79 ASP 79 169 169 ASP ASP A . n A 1 80 LYS 80 170 170 LYS LYS A . n A 1 81 GLU 81 171 171 GLU GLU A . n A 1 82 ARG 82 172 172 ARG ARG A . n A 1 83 ALA 83 173 173 ALA ALA A . n A 1 84 VAL 84 174 174 VAL VAL A . n A 1 85 LEU 85 175 175 LEU LEU A . n A 1 86 LEU 86 176 176 LEU LEU A . n A 1 87 GLN 87 177 177 GLN GLN A . n A 1 88 ARG 88 178 178 ARG ARG A . n A 1 89 ARG 89 179 179 ARG ARG A . n A 1 90 LYS 90 180 180 LYS LYS A . n A 1 91 ARG 91 181 181 ARG ARG A . n A 1 92 GLU 92 182 182 GLU GLU A . n A 1 93 ASN 93 183 183 ASN ASN A . n A 1 94 MET 94 184 184 MET MET A . n A 1 95 SER 95 185 185 SER SER A . n A 1 96 ASP 96 186 186 ASP ASP A . n A 1 97 GLY 97 187 187 GLY GLY A . n A 1 98 ASP 98 188 188 ASP ASP A . n # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Northeast Structural Genomics Consortium' 1 NESG PSI:Biology 'Structural Genomics Consortium' 2 SGC ? 'Chaperone-Enabled Studies of Epigenetic Regulation Enzymes' 3 CEBS PSI:Biology # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 81 ZN ZN A . C 2 ZN 1 202 82 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 53 ? A HIS 143 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 121 ? 1_555 106.9 ? 2 ND1 ? A HIS 53 ? A HIS 143 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 56 ? A CYS 146 ? 1_555 106.9 ? 3 SG ? A CYS 31 ? A CYS 121 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 56 ? A CYS 146 ? 1_555 112.1 ? 4 ND1 ? A HIS 53 ? A HIS 143 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 33 ? A CYS 123 ? 1_555 112.2 ? 5 SG ? A CYS 31 ? A CYS 121 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 33 ? A CYS 123 ? 1_555 107.7 ? 6 SG ? A CYS 56 ? A CYS 146 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 33 ? A CYS 123 ? 1_555 111.1 ? 7 SG ? A CYS 45 ? A CYS 135 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 48 ? A CYS 138 ? 1_555 108.2 ? 8 SG ? A CYS 45 ? A CYS 135 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 73 ? A CYS 163 ? 1_555 108.3 ? 9 SG ? A CYS 48 ? A CYS 138 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 73 ? A CYS 163 ? 1_555 110.5 ? 10 SG ? A CYS 45 ? A CYS 135 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 70 ? A CYS 160 ? 1_555 110.0 ? 11 SG ? A CYS 48 ? A CYS 138 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 70 ? A CYS 160 ? 1_555 109.9 ? 12 SG ? A CYS 73 ? A CYS 163 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 70 ? A CYS 160 ? 1_555 109.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-09-05 2 'Structure model' 1 1 2012-11-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Structure summary' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 0.5 ? mM '[U-13C; U-15N]' 1 TRIS-2 10 ? mM ? 1 'sodium chloride-3' 300 ? mM ? 1 ZnSO4-4 10 ? uM ? 1 DTT-5 1 ? mM ? 1 NaN3-6 0.01 ? % ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 111 ? ? -154.11 -49.68 2 1 ARG A 120 ? ? -113.75 79.78 3 1 LYS A 137 ? ? -74.65 -70.84 4 1 ASP A 169 ? ? -67.01 84.05 5 2 ASP A 169 ? ? -56.10 100.67 6 3 ARG A 120 ? ? -118.89 77.73 7 4 ASP A 128 ? ? -144.11 -21.30 8 5 ARG A 120 ? ? -117.73 74.14 9 6 ARG A 120 ? ? -109.27 74.67 10 7 ASP A 111 ? ? -92.75 47.13 11 7 ASP A 129 ? ? -102.26 -60.73 12 7 SER A 139 ? ? 69.78 -12.41 13 8 ARG A 120 ? ? -109.96 77.64 14 8 ASP A 128 ? ? -143.25 -37.47 15 8 SER A 139 ? ? 58.66 17.96 16 8 SER A 185 ? ? -108.82 76.92 17 9 ARG A 120 ? ? -114.19 77.27 18 9 HIS A 127 ? ? -39.96 114.19 19 9 SER A 185 ? ? -90.14 46.89 20 10 GLU A 110 ? ? -77.73 26.01 21 10 ARG A 120 ? ? -102.04 72.48 22 10 ASP A 169 ? ? -65.54 95.19 23 11 ARG A 120 ? ? -110.54 73.97 24 11 THR A 157 ? ? -102.90 73.15 25 13 ARG A 120 ? ? -114.37 77.02 26 13 SER A 139 ? ? 55.33 17.93 27 14 SER A 113 ? ? -152.70 89.45 28 14 ARG A 120 ? ? -109.47 73.70 29 14 ASP A 186 ? ? -66.32 89.36 30 15 ASP A 111 ? ? -116.53 55.96 31 15 ASP A 129 ? ? -121.94 -65.96 32 16 ARG A 120 ? ? -112.12 74.90 33 16 THR A 157 ? ? -100.38 75.14 34 17 ARG A 120 ? ? -115.71 74.37 35 17 ASP A 129 ? ? -103.20 -66.21 36 17 ASP A 169 ? ? -68.55 88.37 37 18 ARG A 120 ? ? -119.25 78.51 38 19 ARG A 120 ? ? -100.04 74.80 39 20 GLU A 110 ? ? -165.74 96.21 40 20 ARG A 120 ? ? -113.14 75.54 41 20 HIS A 127 ? ? -63.44 93.08 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 91 ? A MET 1 2 1 Y 1 A HIS 92 ? A HIS 2 3 1 Y 1 A HIS 93 ? A HIS 3 4 1 Y 1 A HIS 94 ? A HIS 4 5 1 Y 1 A HIS 95 ? A HIS 5 6 1 Y 1 A HIS 96 ? A HIS 6 7 1 Y 1 A HIS 97 ? A HIS 7 8 1 Y 1 A SER 98 ? A SER 8 9 1 Y 1 A SER 99 ? A SER 9 10 1 Y 1 A GLY 100 ? A GLY 10 11 1 Y 1 A ARG 101 ? A ARG 11 12 1 Y 1 A GLU 102 ? A GLU 12 13 1 Y 1 A ASN 103 ? A ASN 13 14 1 Y 1 A LEU 104 ? A LEU 14 15 1 Y 1 A TYR 105 ? A TYR 15 16 1 Y 1 A PHE 106 ? A PHE 16 17 1 Y 1 A GLN 107 ? A GLN 17 18 1 Y 1 A GLY 108 ? A GLY 18 19 2 Y 1 A MET 91 ? A MET 1 20 2 Y 1 A HIS 92 ? A HIS 2 21 2 Y 1 A HIS 93 ? A HIS 3 22 2 Y 1 A HIS 94 ? A HIS 4 23 2 Y 1 A HIS 95 ? A HIS 5 24 2 Y 1 A HIS 96 ? A HIS 6 25 2 Y 1 A HIS 97 ? A HIS 7 26 2 Y 1 A SER 98 ? A SER 8 27 2 Y 1 A SER 99 ? A SER 9 28 2 Y 1 A GLY 100 ? A GLY 10 29 2 Y 1 A ARG 101 ? A ARG 11 30 2 Y 1 A GLU 102 ? A GLU 12 31 2 Y 1 A ASN 103 ? A ASN 13 32 2 Y 1 A LEU 104 ? A LEU 14 33 2 Y 1 A TYR 105 ? A TYR 15 34 2 Y 1 A PHE 106 ? A PHE 16 35 2 Y 1 A GLN 107 ? A GLN 17 36 2 Y 1 A GLY 108 ? A GLY 18 37 3 Y 1 A MET 91 ? A MET 1 38 3 Y 1 A HIS 92 ? A HIS 2 39 3 Y 1 A HIS 93 ? A HIS 3 40 3 Y 1 A HIS 94 ? A HIS 4 41 3 Y 1 A HIS 95 ? A HIS 5 42 3 Y 1 A HIS 96 ? A HIS 6 43 3 Y 1 A HIS 97 ? A HIS 7 44 3 Y 1 A SER 98 ? A SER 8 45 3 Y 1 A SER 99 ? A SER 9 46 3 Y 1 A GLY 100 ? A GLY 10 47 3 Y 1 A ARG 101 ? A ARG 11 48 3 Y 1 A GLU 102 ? A GLU 12 49 3 Y 1 A ASN 103 ? A ASN 13 50 3 Y 1 A LEU 104 ? A LEU 14 51 3 Y 1 A TYR 105 ? A TYR 15 52 3 Y 1 A PHE 106 ? A PHE 16 53 3 Y 1 A GLN 107 ? A GLN 17 54 3 Y 1 A GLY 108 ? A GLY 18 55 4 Y 1 A MET 91 ? A MET 1 56 4 Y 1 A HIS 92 ? A HIS 2 57 4 Y 1 A HIS 93 ? A HIS 3 58 4 Y 1 A HIS 94 ? A HIS 4 59 4 Y 1 A HIS 95 ? A HIS 5 60 4 Y 1 A HIS 96 ? A HIS 6 61 4 Y 1 A HIS 97 ? A HIS 7 62 4 Y 1 A SER 98 ? A SER 8 63 4 Y 1 A SER 99 ? A SER 9 64 4 Y 1 A GLY 100 ? A GLY 10 65 4 Y 1 A ARG 101 ? A ARG 11 66 4 Y 1 A GLU 102 ? A GLU 12 67 4 Y 1 A ASN 103 ? A ASN 13 68 4 Y 1 A LEU 104 ? A LEU 14 69 4 Y 1 A TYR 105 ? A TYR 15 70 4 Y 1 A PHE 106 ? A PHE 16 71 4 Y 1 A GLN 107 ? A GLN 17 72 4 Y 1 A GLY 108 ? A GLY 18 73 5 Y 1 A MET 91 ? A MET 1 74 5 Y 1 A HIS 92 ? A HIS 2 75 5 Y 1 A HIS 93 ? A HIS 3 76 5 Y 1 A HIS 94 ? A HIS 4 77 5 Y 1 A HIS 95 ? A HIS 5 78 5 Y 1 A HIS 96 ? A HIS 6 79 5 Y 1 A HIS 97 ? A HIS 7 80 5 Y 1 A SER 98 ? A SER 8 81 5 Y 1 A SER 99 ? A SER 9 82 5 Y 1 A GLY 100 ? A GLY 10 83 5 Y 1 A ARG 101 ? A ARG 11 84 5 Y 1 A GLU 102 ? A GLU 12 85 5 Y 1 A ASN 103 ? A ASN 13 86 5 Y 1 A LEU 104 ? A LEU 14 87 5 Y 1 A TYR 105 ? A TYR 15 88 5 Y 1 A PHE 106 ? A PHE 16 89 5 Y 1 A GLN 107 ? A GLN 17 90 5 Y 1 A GLY 108 ? A GLY 18 91 6 Y 1 A MET 91 ? A MET 1 92 6 Y 1 A HIS 92 ? A HIS 2 93 6 Y 1 A HIS 93 ? A HIS 3 94 6 Y 1 A HIS 94 ? A HIS 4 95 6 Y 1 A HIS 95 ? A HIS 5 96 6 Y 1 A HIS 96 ? A HIS 6 97 6 Y 1 A HIS 97 ? A HIS 7 98 6 Y 1 A SER 98 ? A SER 8 99 6 Y 1 A SER 99 ? A SER 9 100 6 Y 1 A GLY 100 ? A GLY 10 101 6 Y 1 A ARG 101 ? A ARG 11 102 6 Y 1 A GLU 102 ? A GLU 12 103 6 Y 1 A ASN 103 ? A ASN 13 104 6 Y 1 A LEU 104 ? A LEU 14 105 6 Y 1 A TYR 105 ? A TYR 15 106 6 Y 1 A PHE 106 ? A PHE 16 107 6 Y 1 A GLN 107 ? A GLN 17 108 6 Y 1 A GLY 108 ? A GLY 18 109 7 Y 1 A MET 91 ? A MET 1 110 7 Y 1 A HIS 92 ? A HIS 2 111 7 Y 1 A HIS 93 ? A HIS 3 112 7 Y 1 A HIS 94 ? A HIS 4 113 7 Y 1 A HIS 95 ? A HIS 5 114 7 Y 1 A HIS 96 ? A HIS 6 115 7 Y 1 A HIS 97 ? A HIS 7 116 7 Y 1 A SER 98 ? A SER 8 117 7 Y 1 A SER 99 ? A SER 9 118 7 Y 1 A GLY 100 ? A GLY 10 119 7 Y 1 A ARG 101 ? A ARG 11 120 7 Y 1 A GLU 102 ? A GLU 12 121 7 Y 1 A ASN 103 ? A ASN 13 122 7 Y 1 A LEU 104 ? A LEU 14 123 7 Y 1 A TYR 105 ? A TYR 15 124 7 Y 1 A PHE 106 ? A PHE 16 125 7 Y 1 A GLN 107 ? A GLN 17 126 7 Y 1 A GLY 108 ? A GLY 18 127 8 Y 1 A MET 91 ? A MET 1 128 8 Y 1 A HIS 92 ? A HIS 2 129 8 Y 1 A HIS 93 ? A HIS 3 130 8 Y 1 A HIS 94 ? A HIS 4 131 8 Y 1 A HIS 95 ? A HIS 5 132 8 Y 1 A HIS 96 ? A HIS 6 133 8 Y 1 A HIS 97 ? A HIS 7 134 8 Y 1 A SER 98 ? A SER 8 135 8 Y 1 A SER 99 ? A SER 9 136 8 Y 1 A GLY 100 ? A GLY 10 137 8 Y 1 A ARG 101 ? A ARG 11 138 8 Y 1 A GLU 102 ? A GLU 12 139 8 Y 1 A ASN 103 ? A ASN 13 140 8 Y 1 A LEU 104 ? A LEU 14 141 8 Y 1 A TYR 105 ? A TYR 15 142 8 Y 1 A PHE 106 ? A PHE 16 143 8 Y 1 A GLN 107 ? A GLN 17 144 8 Y 1 A GLY 108 ? A GLY 18 145 9 Y 1 A MET 91 ? A MET 1 146 9 Y 1 A HIS 92 ? A HIS 2 147 9 Y 1 A HIS 93 ? A HIS 3 148 9 Y 1 A HIS 94 ? A HIS 4 149 9 Y 1 A HIS 95 ? A HIS 5 150 9 Y 1 A HIS 96 ? A HIS 6 151 9 Y 1 A HIS 97 ? A HIS 7 152 9 Y 1 A SER 98 ? A SER 8 153 9 Y 1 A SER 99 ? A SER 9 154 9 Y 1 A GLY 100 ? A GLY 10 155 9 Y 1 A ARG 101 ? A ARG 11 156 9 Y 1 A GLU 102 ? A GLU 12 157 9 Y 1 A ASN 103 ? A ASN 13 158 9 Y 1 A LEU 104 ? A LEU 14 159 9 Y 1 A TYR 105 ? A TYR 15 160 9 Y 1 A PHE 106 ? A PHE 16 161 9 Y 1 A GLN 107 ? A GLN 17 162 9 Y 1 A GLY 108 ? A GLY 18 163 10 Y 1 A MET 91 ? A MET 1 164 10 Y 1 A HIS 92 ? A HIS 2 165 10 Y 1 A HIS 93 ? A HIS 3 166 10 Y 1 A HIS 94 ? A HIS 4 167 10 Y 1 A HIS 95 ? A HIS 5 168 10 Y 1 A HIS 96 ? A HIS 6 169 10 Y 1 A HIS 97 ? A HIS 7 170 10 Y 1 A SER 98 ? A SER 8 171 10 Y 1 A SER 99 ? A SER 9 172 10 Y 1 A GLY 100 ? A GLY 10 173 10 Y 1 A ARG 101 ? A ARG 11 174 10 Y 1 A GLU 102 ? A GLU 12 175 10 Y 1 A ASN 103 ? A ASN 13 176 10 Y 1 A LEU 104 ? A LEU 14 177 10 Y 1 A TYR 105 ? A TYR 15 178 10 Y 1 A PHE 106 ? A PHE 16 179 10 Y 1 A GLN 107 ? A GLN 17 180 10 Y 1 A GLY 108 ? A GLY 18 181 11 Y 1 A MET 91 ? A MET 1 182 11 Y 1 A HIS 92 ? A HIS 2 183 11 Y 1 A HIS 93 ? A HIS 3 184 11 Y 1 A HIS 94 ? A HIS 4 185 11 Y 1 A HIS 95 ? A HIS 5 186 11 Y 1 A HIS 96 ? A HIS 6 187 11 Y 1 A HIS 97 ? A HIS 7 188 11 Y 1 A SER 98 ? A SER 8 189 11 Y 1 A SER 99 ? A SER 9 190 11 Y 1 A GLY 100 ? A GLY 10 191 11 Y 1 A ARG 101 ? A ARG 11 192 11 Y 1 A GLU 102 ? A GLU 12 193 11 Y 1 A ASN 103 ? A ASN 13 194 11 Y 1 A LEU 104 ? A LEU 14 195 11 Y 1 A TYR 105 ? A TYR 15 196 11 Y 1 A PHE 106 ? A PHE 16 197 11 Y 1 A GLN 107 ? A GLN 17 198 11 Y 1 A GLY 108 ? A GLY 18 199 12 Y 1 A MET 91 ? A MET 1 200 12 Y 1 A HIS 92 ? A HIS 2 201 12 Y 1 A HIS 93 ? A HIS 3 202 12 Y 1 A HIS 94 ? A HIS 4 203 12 Y 1 A HIS 95 ? A HIS 5 204 12 Y 1 A HIS 96 ? A HIS 6 205 12 Y 1 A HIS 97 ? A HIS 7 206 12 Y 1 A SER 98 ? A SER 8 207 12 Y 1 A SER 99 ? A SER 9 208 12 Y 1 A GLY 100 ? A GLY 10 209 12 Y 1 A ARG 101 ? A ARG 11 210 12 Y 1 A GLU 102 ? A GLU 12 211 12 Y 1 A ASN 103 ? A ASN 13 212 12 Y 1 A LEU 104 ? A LEU 14 213 12 Y 1 A TYR 105 ? A TYR 15 214 12 Y 1 A PHE 106 ? A PHE 16 215 12 Y 1 A GLN 107 ? A GLN 17 216 12 Y 1 A GLY 108 ? A GLY 18 217 13 Y 1 A MET 91 ? A MET 1 218 13 Y 1 A HIS 92 ? A HIS 2 219 13 Y 1 A HIS 93 ? A HIS 3 220 13 Y 1 A HIS 94 ? A HIS 4 221 13 Y 1 A HIS 95 ? A HIS 5 222 13 Y 1 A HIS 96 ? A HIS 6 223 13 Y 1 A HIS 97 ? A HIS 7 224 13 Y 1 A SER 98 ? A SER 8 225 13 Y 1 A SER 99 ? A SER 9 226 13 Y 1 A GLY 100 ? A GLY 10 227 13 Y 1 A ARG 101 ? A ARG 11 228 13 Y 1 A GLU 102 ? A GLU 12 229 13 Y 1 A ASN 103 ? A ASN 13 230 13 Y 1 A LEU 104 ? A LEU 14 231 13 Y 1 A TYR 105 ? A TYR 15 232 13 Y 1 A PHE 106 ? A PHE 16 233 13 Y 1 A GLN 107 ? A GLN 17 234 13 Y 1 A GLY 108 ? A GLY 18 235 14 Y 1 A MET 91 ? A MET 1 236 14 Y 1 A HIS 92 ? A HIS 2 237 14 Y 1 A HIS 93 ? A HIS 3 238 14 Y 1 A HIS 94 ? A HIS 4 239 14 Y 1 A HIS 95 ? A HIS 5 240 14 Y 1 A HIS 96 ? A HIS 6 241 14 Y 1 A HIS 97 ? A HIS 7 242 14 Y 1 A SER 98 ? A SER 8 243 14 Y 1 A SER 99 ? A SER 9 244 14 Y 1 A GLY 100 ? A GLY 10 245 14 Y 1 A ARG 101 ? A ARG 11 246 14 Y 1 A GLU 102 ? A GLU 12 247 14 Y 1 A ASN 103 ? A ASN 13 248 14 Y 1 A LEU 104 ? A LEU 14 249 14 Y 1 A TYR 105 ? A TYR 15 250 14 Y 1 A PHE 106 ? A PHE 16 251 14 Y 1 A GLN 107 ? A GLN 17 252 14 Y 1 A GLY 108 ? A GLY 18 253 15 Y 1 A MET 91 ? A MET 1 254 15 Y 1 A HIS 92 ? A HIS 2 255 15 Y 1 A HIS 93 ? A HIS 3 256 15 Y 1 A HIS 94 ? A HIS 4 257 15 Y 1 A HIS 95 ? A HIS 5 258 15 Y 1 A HIS 96 ? A HIS 6 259 15 Y 1 A HIS 97 ? A HIS 7 260 15 Y 1 A SER 98 ? A SER 8 261 15 Y 1 A SER 99 ? A SER 9 262 15 Y 1 A GLY 100 ? A GLY 10 263 15 Y 1 A ARG 101 ? A ARG 11 264 15 Y 1 A GLU 102 ? A GLU 12 265 15 Y 1 A ASN 103 ? A ASN 13 266 15 Y 1 A LEU 104 ? A LEU 14 267 15 Y 1 A TYR 105 ? A TYR 15 268 15 Y 1 A PHE 106 ? A PHE 16 269 15 Y 1 A GLN 107 ? A GLN 17 270 15 Y 1 A GLY 108 ? A GLY 18 271 16 Y 1 A MET 91 ? A MET 1 272 16 Y 1 A HIS 92 ? A HIS 2 273 16 Y 1 A HIS 93 ? A HIS 3 274 16 Y 1 A HIS 94 ? A HIS 4 275 16 Y 1 A HIS 95 ? A HIS 5 276 16 Y 1 A HIS 96 ? A HIS 6 277 16 Y 1 A HIS 97 ? A HIS 7 278 16 Y 1 A SER 98 ? A SER 8 279 16 Y 1 A SER 99 ? A SER 9 280 16 Y 1 A GLY 100 ? A GLY 10 281 16 Y 1 A ARG 101 ? A ARG 11 282 16 Y 1 A GLU 102 ? A GLU 12 283 16 Y 1 A ASN 103 ? A ASN 13 284 16 Y 1 A LEU 104 ? A LEU 14 285 16 Y 1 A TYR 105 ? A TYR 15 286 16 Y 1 A PHE 106 ? A PHE 16 287 16 Y 1 A GLN 107 ? A GLN 17 288 16 Y 1 A GLY 108 ? A GLY 18 289 17 Y 1 A MET 91 ? A MET 1 290 17 Y 1 A HIS 92 ? A HIS 2 291 17 Y 1 A HIS 93 ? A HIS 3 292 17 Y 1 A HIS 94 ? A HIS 4 293 17 Y 1 A HIS 95 ? A HIS 5 294 17 Y 1 A HIS 96 ? A HIS 6 295 17 Y 1 A HIS 97 ? A HIS 7 296 17 Y 1 A SER 98 ? A SER 8 297 17 Y 1 A SER 99 ? A SER 9 298 17 Y 1 A GLY 100 ? A GLY 10 299 17 Y 1 A ARG 101 ? A ARG 11 300 17 Y 1 A GLU 102 ? A GLU 12 301 17 Y 1 A ASN 103 ? A ASN 13 302 17 Y 1 A LEU 104 ? A LEU 14 303 17 Y 1 A TYR 105 ? A TYR 15 304 17 Y 1 A PHE 106 ? A PHE 16 305 17 Y 1 A GLN 107 ? A GLN 17 306 17 Y 1 A GLY 108 ? A GLY 18 307 18 Y 1 A MET 91 ? A MET 1 308 18 Y 1 A HIS 92 ? A HIS 2 309 18 Y 1 A HIS 93 ? A HIS 3 310 18 Y 1 A HIS 94 ? A HIS 4 311 18 Y 1 A HIS 95 ? A HIS 5 312 18 Y 1 A HIS 96 ? A HIS 6 313 18 Y 1 A HIS 97 ? A HIS 7 314 18 Y 1 A SER 98 ? A SER 8 315 18 Y 1 A SER 99 ? A SER 9 316 18 Y 1 A GLY 100 ? A GLY 10 317 18 Y 1 A ARG 101 ? A ARG 11 318 18 Y 1 A GLU 102 ? A GLU 12 319 18 Y 1 A ASN 103 ? A ASN 13 320 18 Y 1 A LEU 104 ? A LEU 14 321 18 Y 1 A TYR 105 ? A TYR 15 322 18 Y 1 A PHE 106 ? A PHE 16 323 18 Y 1 A GLN 107 ? A GLN 17 324 18 Y 1 A GLY 108 ? A GLY 18 325 19 Y 1 A MET 91 ? A MET 1 326 19 Y 1 A HIS 92 ? A HIS 2 327 19 Y 1 A HIS 93 ? A HIS 3 328 19 Y 1 A HIS 94 ? A HIS 4 329 19 Y 1 A HIS 95 ? A HIS 5 330 19 Y 1 A HIS 96 ? A HIS 6 331 19 Y 1 A HIS 97 ? A HIS 7 332 19 Y 1 A SER 98 ? A SER 8 333 19 Y 1 A SER 99 ? A SER 9 334 19 Y 1 A GLY 100 ? A GLY 10 335 19 Y 1 A ARG 101 ? A ARG 11 336 19 Y 1 A GLU 102 ? A GLU 12 337 19 Y 1 A ASN 103 ? A ASN 13 338 19 Y 1 A LEU 104 ? A LEU 14 339 19 Y 1 A TYR 105 ? A TYR 15 340 19 Y 1 A PHE 106 ? A PHE 16 341 19 Y 1 A GLN 107 ? A GLN 17 342 19 Y 1 A GLY 108 ? A GLY 18 343 20 Y 1 A MET 91 ? A MET 1 344 20 Y 1 A HIS 92 ? A HIS 2 345 20 Y 1 A HIS 93 ? A HIS 3 346 20 Y 1 A HIS 94 ? A HIS 4 347 20 Y 1 A HIS 95 ? A HIS 5 348 20 Y 1 A HIS 96 ? A HIS 6 349 20 Y 1 A HIS 97 ? A HIS 7 350 20 Y 1 A SER 98 ? A SER 8 351 20 Y 1 A SER 99 ? A SER 9 352 20 Y 1 A GLY 100 ? A GLY 10 353 20 Y 1 A ARG 101 ? A ARG 11 354 20 Y 1 A GLU 102 ? A GLU 12 355 20 Y 1 A ASN 103 ? A ASN 13 356 20 Y 1 A LEU 104 ? A LEU 14 357 20 Y 1 A TYR 105 ? A TYR 15 358 20 Y 1 A PHE 106 ? A PHE 16 359 20 Y 1 A GLN 107 ? A GLN 17 360 20 Y 1 A GLY 108 ? A GLY 18 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #