data_2LVH # _entry.id 2LVH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LVH pdb_00002lvh 10.2210/pdb2lvh/pdb RCSB RCSB102882 ? ? BMRB 18570 ? ? WWPDB D_1000102882 ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 18570 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LVH _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-07-05 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Guilliere, F.' 1 'Sezonov, G.' 2 'Prangishvili, D.' 3 'Delepierre, M.' 4 'Guijarro, J.' 5 # _citation.id primary _citation.title 'Solution structure of an archaeal DNA binding protein with an eukaryotic zinc finger fold.' _citation.journal_abbrev 'Plos One' _citation.journal_volume 8 _citation.page_first e52908 _citation.page_last e52908 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1932-6203 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23326363 _citation.pdbx_database_id_DOI 10.1371/journal.pone.0052908 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guilliere, F.' 1 ? primary 'Danioux, C.' 2 ? primary 'Jaubert, C.' 3 ? primary 'Desnoues, N.' 4 ? primary 'Delepierre, M.' 5 ? primary 'Prangishvili, D.' 6 ? primary 'Sezonov, G.' 7 ? primary 'Guijarro, J.I.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative zinc finger protein ORF59a' 7010.232 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MIEVSSMERVYQCLRCGLTFRTKKQLIRHLVNTEKVNPLSIDYYYQSFSVSLKDVNKII _entity_poly.pdbx_seq_one_letter_code_can MIEVSSMERVYQCLRCGLTFRTKKQLIRHLVNTEKVNPLSIDYYYQSFSVSLKDVNKII _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 GLU n 1 4 VAL n 1 5 SER n 1 6 SER n 1 7 MET n 1 8 GLU n 1 9 ARG n 1 10 VAL n 1 11 TYR n 1 12 GLN n 1 13 CYS n 1 14 LEU n 1 15 ARG n 1 16 CYS n 1 17 GLY n 1 18 LEU n 1 19 THR n 1 20 PHE n 1 21 ARG n 1 22 THR n 1 23 LYS n 1 24 LYS n 1 25 GLN n 1 26 LEU n 1 27 ILE n 1 28 ARG n 1 29 HIS n 1 30 LEU n 1 31 VAL n 1 32 ASN n 1 33 THR n 1 34 GLU n 1 35 LYS n 1 36 VAL n 1 37 ASN n 1 38 PRO n 1 39 LEU n 1 40 SER n 1 41 ILE n 1 42 ASP n 1 43 TYR n 1 44 TYR n 1 45 TYR n 1 46 GLN n 1 47 SER n 1 48 PHE n 1 49 SER n 1 50 VAL n 1 51 SER n 1 52 LEU n 1 53 LYS n 1 54 ASP n 1 55 VAL n 1 56 ASN n 1 57 LYS n 1 58 ILE n 1 59 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ORF59a _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Yellowstone _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Acidianus filamentous virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 654909 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET-30a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y059A_AFV1Y _struct_ref.pdbx_db_accession Q70LE5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MIEVSSMERVYQCLRCGLTFRTKKQLIRHLVNTEKVNPLSIDYYYQSFSVSLKDVNKII _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LVH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 59 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q70LE5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 59 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 59 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '2D 1H-13C HSQC aliphatic' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D HNCO' 1 7 1 '3D C(CO)NH' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D HNHA' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '2D 1H-13C HSQC aliphatic' 1 12 1 '2D 1H-13C HSQC aromatic' 1 13 1 '2D (HB)CB(CGCD)HD aromatic' 1 14 1 '2D (HB)CB(CGCDCE)HE aromatic' 1 15 1 '3D 1H-13C NOESY aliphatic' 1 16 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298.15 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.8-1 mM [U-98% 13C; U-98% 15N] AFV1p06, 88% H2O/12% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '88% H2O/12% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model 'NMR System' _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian NMR System' # _pdbx_nmr_refine.entry_id 2LVH _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 150 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LVH _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LVH _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VnmrJ 2.3A 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Johnson, One Moon Scientific' 'data analysis' NMRView 5.3 3 'Johnson, One Moon Scientific' 'peak picking' NMRView 5.3 4 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView 5.3 5 ;Linge, O'Donoghue and Nilges ; 'automated noe assignment' ARIA 2.2 6 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 2.2 7 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.2 8 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 9 'Cornilescu, Delaglio and Bax' 'dihedral constraints' TALOS ? 10 'Laskowski, MacArthur, Smith, Jones, Hutchinson, Morris, Moss and Tho' 'structure analysis' Procheck 3.5.4 11 Vriend 'structure analysis' WhatCheck ? 12 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL 2K.2 13 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LVH _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LVH _struct.title 'Solution structure of the zinc finger AFV1p06 protein from the hyperthermophilic archaeal virus AFV1' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LVH _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'Zinc finger, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 22 ? THR A 33 ? THR A 22 THR A 33 1 ? 12 HELX_P HELX_P2 2 SER A 40 ? TYR A 43 ? SER A 40 TYR A 43 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 13 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 13 A ZN 101 1_555 ? ? ? ? ? ? ? 2.311 ? ? metalc2 metalc ? ? A CYS 16 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 16 A ZN 101 1_555 ? ? ? ? ? ? ? 2.305 ? ? metalc3 metalc ? ? A HIS 29 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 29 A ZN 101 1_555 ? ? ? ? ? ? ? 1.998 ? ? metalc4 metalc ? ? A GLU 34 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 34 A ZN 101 1_555 ? ? ? ? ? ? ? 1.931 ? ? metalc5 metalc ? ? A GLU 34 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 34 A ZN 101 1_555 ? ? ? ? ? ? ? 2.385 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 19 ? PHE A 20 ? THR A 19 PHE A 20 A 2 GLU A 8 ? CYS A 13 ? GLU A 8 CYS A 13 A 3 TYR A 45 ? VAL A 50 ? TYR A 45 VAL A 50 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 20 ? O PHE A 20 N TYR A 11 ? N TYR A 11 A 2 3 N GLU A 8 ? N GLU A 8 O VAL A 50 ? O VAL A 50 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 13 ? CYS A 13 . ? 1_555 ? 2 AC1 4 CYS A 16 ? CYS A 16 . ? 1_555 ? 3 AC1 4 HIS A 29 ? HIS A 29 . ? 1_555 ? 4 AC1 4 GLU A 34 ? GLU A 34 . ? 1_555 ? # _atom_sites.entry_id 2LVH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ILE 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 SER 6 6 ? ? ? A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 LEU 52 52 ? ? ? A . n A 1 53 LYS 53 53 ? ? ? A . n A 1 54 ASP 54 54 ? ? ? A . n A 1 55 VAL 55 55 ? ? ? A . n A 1 56 ASN 56 56 ? ? ? A . n A 1 57 LYS 57 57 ? ? ? A . n A 1 58 ILE 58 58 ? ? ? A . n A 1 59 ILE 59 59 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 52 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 16 ? A CYS 16 ? 1_555 105.8 ? 2 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 29 ? A HIS 29 ? 1_555 106.7 ? 3 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 29 ? A HIS 29 ? 1_555 110.9 ? 4 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE2 ? A GLU 34 ? A GLU 34 ? 1_555 86.0 ? 5 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE2 ? A GLU 34 ? A GLU 34 ? 1_555 118.9 ? 6 NE2 ? A HIS 29 ? A HIS 29 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE2 ? A GLU 34 ? A GLU 34 ? 1_555 122.6 ? 7 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE1 ? A GLU 34 ? A GLU 34 ? 1_555 143.4 ? 8 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE1 ? A GLU 34 ? A GLU 34 ? 1_555 100.1 ? 9 NE2 ? A HIS 29 ? A HIS 29 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE1 ? A GLU 34 ? A GLU 34 ? 1_555 87.2 ? 10 OE2 ? A GLU 34 ? A GLU 34 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE1 ? A GLU 34 ? A GLU 34 ? 1_555 58.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-01-30 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_struct_conn_angle 5 2 'Structure model' struct_conn 6 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.value' 16 2 'Structure model' '_struct_conn.pdbx_dist_value' 17 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 23 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 24 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.0194 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.0037 _pdbx_nmr_ensemble_rms.entry_id 2LVH _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_exptl_sample.component AFV1p06-1 _pdbx_nmr_exptl_sample.concentration ? _pdbx_nmr_exptl_sample.concentration_range 0.8-1 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-98% 13C; U-98% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LVH _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 19 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 959 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 380 _pdbx_nmr_constraints.NOE_long_range_total_count 220 _pdbx_nmr_constraints.NOE_medium_range_total_count 157 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 202 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 40 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 37 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 4 _pdbx_validate_close_contact.auth_atom_id_1 HA _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 11 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HB2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 47 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.21 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 4 SER A 47 ? ? -174.87 -174.03 2 7 ARG A 15 ? ? -100.91 -60.87 3 8 ARG A 15 ? ? -99.81 -60.85 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 51 ? O ? A SER 51 O 2 2 Y 1 A SER 51 ? O ? A SER 51 O 3 3 Y 1 A SER 51 ? O ? A SER 51 O 4 4 Y 1 A SER 51 ? O ? A SER 51 O 5 5 Y 1 A SER 51 ? O ? A SER 51 O 6 6 Y 1 A SER 51 ? O ? A SER 51 O 7 7 Y 1 A SER 51 ? O ? A SER 51 O 8 8 Y 1 A SER 51 ? O ? A SER 51 O 9 9 Y 1 A SER 51 ? O ? A SER 51 O 10 10 Y 1 A SER 51 ? O ? A SER 51 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ILE 2 ? A ILE 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A SER 6 ? A SER 6 7 1 Y 1 A LEU 52 ? A LEU 52 8 1 Y 1 A LYS 53 ? A LYS 53 9 1 Y 1 A ASP 54 ? A ASP 54 10 1 Y 1 A VAL 55 ? A VAL 55 11 1 Y 1 A ASN 56 ? A ASN 56 12 1 Y 1 A LYS 57 ? A LYS 57 13 1 Y 1 A ILE 58 ? A ILE 58 14 1 Y 1 A ILE 59 ? A ILE 59 15 2 Y 1 A MET 1 ? A MET 1 16 2 Y 1 A ILE 2 ? A ILE 2 17 2 Y 1 A GLU 3 ? A GLU 3 18 2 Y 1 A VAL 4 ? A VAL 4 19 2 Y 1 A SER 5 ? A SER 5 20 2 Y 1 A SER 6 ? A SER 6 21 2 Y 1 A LEU 52 ? A LEU 52 22 2 Y 1 A LYS 53 ? A LYS 53 23 2 Y 1 A ASP 54 ? A ASP 54 24 2 Y 1 A VAL 55 ? A VAL 55 25 2 Y 1 A ASN 56 ? A ASN 56 26 2 Y 1 A LYS 57 ? A LYS 57 27 2 Y 1 A ILE 58 ? A ILE 58 28 2 Y 1 A ILE 59 ? A ILE 59 29 3 Y 1 A MET 1 ? A MET 1 30 3 Y 1 A ILE 2 ? A ILE 2 31 3 Y 1 A GLU 3 ? A GLU 3 32 3 Y 1 A VAL 4 ? A VAL 4 33 3 Y 1 A SER 5 ? A SER 5 34 3 Y 1 A SER 6 ? A SER 6 35 3 Y 1 A LEU 52 ? A LEU 52 36 3 Y 1 A LYS 53 ? A LYS 53 37 3 Y 1 A ASP 54 ? A ASP 54 38 3 Y 1 A VAL 55 ? A VAL 55 39 3 Y 1 A ASN 56 ? A ASN 56 40 3 Y 1 A LYS 57 ? A LYS 57 41 3 Y 1 A ILE 58 ? A ILE 58 42 3 Y 1 A ILE 59 ? A ILE 59 43 4 Y 1 A MET 1 ? A MET 1 44 4 Y 1 A ILE 2 ? A ILE 2 45 4 Y 1 A GLU 3 ? A GLU 3 46 4 Y 1 A VAL 4 ? A VAL 4 47 4 Y 1 A SER 5 ? A SER 5 48 4 Y 1 A SER 6 ? A SER 6 49 4 Y 1 A LEU 52 ? A LEU 52 50 4 Y 1 A LYS 53 ? A LYS 53 51 4 Y 1 A ASP 54 ? A ASP 54 52 4 Y 1 A VAL 55 ? A VAL 55 53 4 Y 1 A ASN 56 ? A ASN 56 54 4 Y 1 A LYS 57 ? A LYS 57 55 4 Y 1 A ILE 58 ? A ILE 58 56 4 Y 1 A ILE 59 ? A ILE 59 57 5 Y 1 A MET 1 ? A MET 1 58 5 Y 1 A ILE 2 ? A ILE 2 59 5 Y 1 A GLU 3 ? A GLU 3 60 5 Y 1 A VAL 4 ? A VAL 4 61 5 Y 1 A SER 5 ? A SER 5 62 5 Y 1 A SER 6 ? A SER 6 63 5 Y 1 A LEU 52 ? A LEU 52 64 5 Y 1 A LYS 53 ? A LYS 53 65 5 Y 1 A ASP 54 ? A ASP 54 66 5 Y 1 A VAL 55 ? A VAL 55 67 5 Y 1 A ASN 56 ? A ASN 56 68 5 Y 1 A LYS 57 ? A LYS 57 69 5 Y 1 A ILE 58 ? A ILE 58 70 5 Y 1 A ILE 59 ? A ILE 59 71 6 Y 1 A MET 1 ? A MET 1 72 6 Y 1 A ILE 2 ? A ILE 2 73 6 Y 1 A GLU 3 ? A GLU 3 74 6 Y 1 A VAL 4 ? A VAL 4 75 6 Y 1 A SER 5 ? A SER 5 76 6 Y 1 A SER 6 ? A SER 6 77 6 Y 1 A LEU 52 ? A LEU 52 78 6 Y 1 A LYS 53 ? A LYS 53 79 6 Y 1 A ASP 54 ? A ASP 54 80 6 Y 1 A VAL 55 ? A VAL 55 81 6 Y 1 A ASN 56 ? A ASN 56 82 6 Y 1 A LYS 57 ? A LYS 57 83 6 Y 1 A ILE 58 ? A ILE 58 84 6 Y 1 A ILE 59 ? A ILE 59 85 7 Y 1 A MET 1 ? A MET 1 86 7 Y 1 A ILE 2 ? A ILE 2 87 7 Y 1 A GLU 3 ? A GLU 3 88 7 Y 1 A VAL 4 ? A VAL 4 89 7 Y 1 A SER 5 ? A SER 5 90 7 Y 1 A SER 6 ? A SER 6 91 7 Y 1 A LEU 52 ? A LEU 52 92 7 Y 1 A LYS 53 ? A LYS 53 93 7 Y 1 A ASP 54 ? A ASP 54 94 7 Y 1 A VAL 55 ? A VAL 55 95 7 Y 1 A ASN 56 ? A ASN 56 96 7 Y 1 A LYS 57 ? A LYS 57 97 7 Y 1 A ILE 58 ? A ILE 58 98 7 Y 1 A ILE 59 ? A ILE 59 99 8 Y 1 A MET 1 ? A MET 1 100 8 Y 1 A ILE 2 ? A ILE 2 101 8 Y 1 A GLU 3 ? A GLU 3 102 8 Y 1 A VAL 4 ? A VAL 4 103 8 Y 1 A SER 5 ? A SER 5 104 8 Y 1 A SER 6 ? A SER 6 105 8 Y 1 A LEU 52 ? A LEU 52 106 8 Y 1 A LYS 53 ? A LYS 53 107 8 Y 1 A ASP 54 ? A ASP 54 108 8 Y 1 A VAL 55 ? A VAL 55 109 8 Y 1 A ASN 56 ? A ASN 56 110 8 Y 1 A LYS 57 ? A LYS 57 111 8 Y 1 A ILE 58 ? A ILE 58 112 8 Y 1 A ILE 59 ? A ILE 59 113 9 Y 1 A MET 1 ? A MET 1 114 9 Y 1 A ILE 2 ? A ILE 2 115 9 Y 1 A GLU 3 ? A GLU 3 116 9 Y 1 A VAL 4 ? A VAL 4 117 9 Y 1 A SER 5 ? A SER 5 118 9 Y 1 A SER 6 ? A SER 6 119 9 Y 1 A LEU 52 ? A LEU 52 120 9 Y 1 A LYS 53 ? A LYS 53 121 9 Y 1 A ASP 54 ? A ASP 54 122 9 Y 1 A VAL 55 ? A VAL 55 123 9 Y 1 A ASN 56 ? A ASN 56 124 9 Y 1 A LYS 57 ? A LYS 57 125 9 Y 1 A ILE 58 ? A ILE 58 126 9 Y 1 A ILE 59 ? A ILE 59 127 10 Y 1 A MET 1 ? A MET 1 128 10 Y 1 A ILE 2 ? A ILE 2 129 10 Y 1 A GLU 3 ? A GLU 3 130 10 Y 1 A VAL 4 ? A VAL 4 131 10 Y 1 A SER 5 ? A SER 5 132 10 Y 1 A SER 6 ? A SER 6 133 10 Y 1 A LEU 52 ? A LEU 52 134 10 Y 1 A LYS 53 ? A LYS 53 135 10 Y 1 A ASP 54 ? A ASP 54 136 10 Y 1 A VAL 55 ? A VAL 55 137 10 Y 1 A ASN 56 ? A ASN 56 138 10 Y 1 A LYS 57 ? A LYS 57 139 10 Y 1 A ILE 58 ? A ILE 58 140 10 Y 1 A ILE 59 ? A ILE 59 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #